KEGG   Aeromonas hydrophila YL17: AI20_09065Help
Entry
AI20_09065        CDS       T03186                                 

Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
ahd  Aeromonas hydrophila YL17
Pathway
ahd00561  Glycerolipid metabolism
ahd00640  Propanoate metabolism
ahd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ahd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AI20_09065
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    AI20_09065
Enzymes [BR:ahd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     AI20_09065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase TINF2_N
Motif
Other DBs
NCBI-ProteinID: AHV35327
Position
complement(3358728..3359846)
Genome map
AA seq 372 aa AA seqDB search
MPILPRTVTSPKKFIIGHDLLPQLHDHVKDFGDNALLVSDEFILERVREEALAGLLQAGL
KGAVEKFNYECTDIEIRRLCDLAEQQGANVIVGIGGGKTLDVAKAVAFYLRRPVVLFPTI
ASTDAPCTALAVIYNPAGEFERYLFLPQNPDVVIADTAIIAAAPARFFAAGVGDALATYF
EARACYRADGINLVGKRPSRTGLGLARLCYELLGENIELAMDAVRHHVTTPALEQTIEAT
IYLSGVGAEAGGLAAAHAVNNGMSVVPDLHRVQHGEKVVFGLLTQLVLERAPQAELDEVM
RIIQLAGLPMTLQEMGLSQFVESEWRQVAKLACDPLDTMGNMPMSVSEQDVYHAMIAANA
MAERYRARHPRT
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcctatcctgcctcgtaccgtcacctcccccaaaaagttcatcatcggccacgatctg
ctgccccaactccatgatcacgtaaaagatttcggcgacaatgccctgcttgtcagcgac
gaattcattctggagcgggtacgggaagaggcgctggccggcctgctgcaggcgggcctg
aagggtgcggtcgagaagttcaactacgagtgtaccgacatcgagatccgccgcctgtgc
gatctggccgaacaacagggggccaacgttatcgtcggcatcggcggcggcaagactctg
gacgtcgccaaggcggtggccttctacctgcgccgccccgtggtactgtttcctaccatc
gcctccaccgatgccccctgcaccgccctcgcggtgatctacaacccggcgggggagttc
gaacgctatctgttcctgccccagaacccggacgtggtgatcgccgataccgccatcata
gcggccgcccccgcccgcttctttgccgccggcgtgggcgatgcccttgccacctatttc
gaggcccgcgcctgttaccgggccgacggcatcaatctggtgggcaaacgcccctcccgc
accggcctcgggctggcccggctctgctatgaactgctgggggagaacatcgagctggcg
atggacgcggtgcgccatcacgtcaccaccccggcgctggagcagaccatcgaggccacc
atctatctgagtggcgtaggtgccgaggcgggcggcctggcggcggcccatgcggtcaac
aacggcatgtcggtggtgccagatctgcaccgagtccagcatggtgagaaagtggtgttc
ggcctgctcacccagctggtgctcgaacgcgccccccaggccgagctcgacgaggtgatg
cgcatcatccagctggccggcctgcccatgaccctgcaggagatgggactgagccagttc
gtggagagcgagtggcgccaggtggccaagcttgcctgcgatcctctcgacaccatgggc
aacatgccgatgagcgtcagcgagcaggatgtctaccacgccatgatcgcggccaatgcc
atggccgagcgctaccgggcccgtcacccacgcacctga

DBGET integrated database retrieval system