KEGG   Aeromonas hydrophila YL17: AI20_11945Help
Entry
AI20_11945        CDS       T03186                                 

Definition
(GenBank) D-serine dehydratase
  KO
K01753  D-serine dehydratase [EC:4.3.1.18]
Organism
ahd  Aeromonas hydrophila YL17
Pathway
ahd00260  Glycine, serine and threonine metabolism
ahd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ahd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AI20_11945
Enzymes [BR:ahd01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.18  D-serine ammonia-lyase
     AI20_11945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AHV35875
Position
complement(2700076..2701407)
Genome map
AA seq 443 aa AA seqDB search
MKNIDVSQLTQQFPLLHSLIALEPISWFNPRATPLVEGLPHVGLDDSDVADASARLARFA
PYLCEAFPETRASKGILESEIAAIPTMQRALNTRYGVKVSGRLLLKKDSHLPISGSIKAR
GGIYEVLTHAEQLSIKAGLLCEEDDYRKLFTDEFRHFFSQYSIAVGSTGNLGMSIGIMSA
RLGFRVTVHMSADAREWKKRKLREHGAIVVEYAEDYGVAVEQGRKEAERDPNCFFIDDEN
SRTLFLGYAVAGERVKQQFDEMGIKVDADHPLFVYLPCGVGGGPGGVAFGLKLAFGDNVH
CLFAEPTHSPCMLLGVHTGLHDAIAVQDLGIDNLTAADGLAVGRASGFVGRAMERLLAGF
YTLSDQEMYDLLGLLARDEQIRLEPSALAGMAGPWRVAADLEWQTGQGLDAAKMASATHL
VWATGGGMVPAEEMEKYLASARL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacatcgacgtatcacaactcacccagcagtttccgctgctgcactccctgatc
gcgctggagccaatcagctggttcaaccccagggccacccccctggtggaaggtctgccc
cacgtgggactggatgacagcgatgtggcggatgcctccgccaggctcgcccgcttcgcc
ccctacctgtgcgaagccttccccgagacccgcgccagcaagggcattctggagtccgag
atcgccgccatcccgaccatgcagcgcgccctgaatacccgttacggggtcaaggtgagc
ggccggctgctactcaaaaaagacagccacctgcccatctccggctccatcaaggcacgc
ggcggtatctacgaggtgctgacccacgccgagcagttgtccatcaaggccggtctgctc
tgcgaagaggacgactatcgcaagctgttcacggacgagttccgccacttcttcagccag
tacagcatcgcggtcggctccactggcaaccttggcatgtccatcggcatcatgagcgcc
cgcctcggctttcgcgtcaccgtccatatgtccgccgatgcgcgggagtggaagaagcgc
aagttgcgcgaacatggcgccatcgtggtggaatacgccgaagattacggggtggcggtg
gagcagggacgcaaggaggccgaacgcgaccccaactgtttcttcatcgatgacgagaac
tcccgcactctgttcctcggctacgcggtggccggtgagcgggtgaaacagcagttcgac
gagatgggcatcaaggtggatgccgaccatccgctgtttgtctacctgccttgcggtgtc
ggcggcggccccggcggggtggcctttggcctcaagctcgcgttcggggacaacgtccac
tgcctgttcgccgagccgacccactccccctgcatgctgctaggggtgcacaccggcttg
cacgatgccattgcggtgcaagaccttggcatcgacaacctcaccgctgccgacggcctc
gcggtggggcgcgcctccggcttcgtcggtcgcgccatggagcgactgctggcaggtttc
tacaccctgagcgatcaggagatgtacgacctgctgggactcttggcccgcgatgagcag
atcaggctcgagccttctgcgctggccggcatggcaggcccgtggcgcgtcgcggccgac
cttgagtggcaaactggtcaagggctggatgccgccaagatggccagcgctacccacctg
gtgtgggccaccggcggcggcatggtgcccgccgaggagatggaaaagtacctggccagc
gcccgcctctga

DBGET integrated database retrieval system