KEGG   Aeromonas hydrophila YL17: AI20_13390Help
Entry
AI20_13390        CDS       T03186                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
ahd  Aeromonas hydrophila YL17
Brite
KEGG Orthology (KO) [BR:ahd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ahd03016]
    AI20_13390
Enzymes [BR:ahd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     AI20_13390
Transfer RNA biogenesis [BR:ahd03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    AI20_13390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AHV36148
Position
2376024..2376764
Genome map
AA seq 246 aa AA seqDB search
MKLTLLYQDDWLVAVNKPSGLLVHRSWLDKAETRFAMQMTRDLIGGRHVYPVHRLDRPTS
GVLLFALDPAVARTLTEAFAARQVHKEYLALVRGWAPEQGVIDYPLKEQLDKIADAMSDP
DRPAQEAVTAFCRLHQVELPYAVSKKHPTSRYSLVRLFPKTGRKHQLRRHLDHLFHPIVG
DTTHGDGRHNRFFREHYGCDRLLLVARTLSFQHPVLKVPMRIQAPLGSHVLQLFAALGWP
ASESDY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgaccctgctctaccaggatgactggctggtggcggtcaacaagccctccggt
ctgctggtgcaccgcagctggctcgacaaggccgaaacccgttttgccatgcagatgacc
cgggatctcatcggcggtcgtcacgtctacccggtacatcggctggacagacccacctcg
ggggtgctgctgtttgccctcgatcctgccgtggcccgtaccctgaccgaggcctttgcc
gcccgtcaggtccacaaggagtatctggcgctggtgcgaggctgggctccggagcagggg
gtgatcgactaccccctcaaggagcaactggacaagatcgccgatgccatgagcgatccg
gatcgtccggcccaggaggcggtgaccgcgttttgtcgcctgcatcaggtcgagctgccc
tatgcggtctccaagaaacaccccaccagtcgctacagcctggtccgcctgtttcccaag
acgggtcgcaagcatcagctgcgccgtcacctcgatcatctgttccaccccatcgtcggt
gacaccacccatggcgatggccgccacaaccgcttctttcgcgagcactatggttgcgat
cgcctgctgctggtggcccgcaccctcagcttccagcatccggtgctgaaggtgccgatg
cgcatccaggccccgctggggtcgcacgtgctgcagctgtttgccgcactgggctggcct
gccagcgagagcgactactga

DBGET integrated database retrieval system