KEGG   Aeromonas hydrophila YL17: AI20_14540Help
Entry
AI20_14540        CDS       T03186                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
ahd  Aeromonas hydrophila YL17
Brite
KEGG Orthology (KO) [BR:ahd00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AI20_14540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AHV36357
Position
complement(2136213..2136575)
Genome map
AA seq 120 aa AA seqDB search
MATPHILVRPYPSYVADSKDPYQFHYLIEIENLGPGPAQLLRRRWLITDANGKMLEVEGP
GVVGEQPVIAPGETFRYQSGVPLATPLGVMEGSYTLQDESGQQFEVPIAPFTLAVPHIIN
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaccccgcacatcctagtccgcccatacccctcgtatgtggcggatagcaaagac
ccttaccagtttcactatctcatcgagatcgagaacctggggcccggcccggcgcaactg
ctgcgccggcgctggctcatcactgatgccaatggcaaaatgctggaagtcgaaggcccc
ggcgtggtcggcgagcagccggtcatcgcccccggcgagaccttccgctatcagagcggc
gtgccgctggccaccccgctcggcgtgatggaagggagttataccctgcaagacgagtcg
gggcagcaattcgaggtgcccatcgcaccctttacgctggccgtcccccacattatcaac
tga

DBGET integrated database retrieval system