KEGG   Arcanobacterium haemolyticum: Arch_0726Help
Entry
Arch_0726         CDS       T01242                                 

Definition
(GenBank) Polyphosphate--glucose phosphotransferase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
ahe  Arcanobacterium haemolyticum
Pathway
ahe00010  Glycolysis / Gluconeogenesis
ahe00520  Amino sugar and nucleotide sugar metabolism
ahe01100  Metabolic pathways
ahe01110  Biosynthesis of secondary metabolites
ahe01120  Microbial metabolism in diverse environments
ahe01130  Biosynthesis of antibiotics
ahe01200  Carbon metabolism
Module
ahe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ahe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arch_0726
   00520 Amino sugar and nucleotide sugar metabolism
    Arch_0726
Enzymes [BR:ahe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Arch_0726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK DUF4445 DUF1092
Motif
Other DBs
NCBI-ProteinID: ADH92458
UniProt: D7BNF9
Position
complement(823743..824513)
Genome map
AA seq 256 aa AA seqDB search
MSHQLAKVAIGVDIGGSAIKGSVVNLETGEFVGEQNKIPNPANATPQQVASIVAQIVESF
DVPADTPVGVTFPAPIINGVCPMVANLNQDFTGMDIADLMNTTVGRPVTVLNDADAAGIA
EAEYGGARGRKGTIIVLTLGTGIGSALVRDGVLVPNTEMGHLLLPNGLKAEKWAASSIRT
KEELSLEEWAHRLQDVLDAVEMLFSPDTLILGGGISTRFDEFSEFLTVRAAIEPARLFNT
AGIAGAALVAAQSGQA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgtcccatcagctagcaaaagttgctatcggagtcgatatcggcggatcagccatcaaa
ggttcggttgtcaatctagaaaccggagaattcgttggcgaacaaaacaaaatccctaac
cccgccaatgccaccccacagcaggtagccagcatcgttgcccagattgttgagagcttc
gatgttcctgccgataccccggtaggcgtcacattcccagcccccatcatcaacggcgta
tgccccatggtggcaaacctcaaccaagatttcacgggcatggatatcgcggacctgatg
aacaccaccgttggccggccagtcaccgtgctcaatgatgccgatgcagccggaatcgcc
gaagcggaatacggcggagcccgcgggcgcaagggcaccatcatcgtgctcacgctcggc
accggaatcggatccgcactggttcgcgatggcgtgcttgtgccaaataccgaaatgggg
cacctgcttctaccaaacggtttaaaggcagaaaagtgggccgcatcctccatccgcacc
aaggaagaactatccctagaagaatgggcacaccgtttgcaagatgttcttgacgcggta
gaaatgctcttctcccccgatacgttgatcttgggcggcggcatctctacacggttcgat
gaattttcagagtttttgacagtgcgcgccgcgatcgaacctgctcgcctgttcaacacg
gcaggaatcgcgggggctgccctggttgcggcgcaatcagggcaggcgtaa

DBGET integrated database retrieval system