KEGG   Arcanobacterium haemolyticum: Arch_1113Help
Entry
Arch_1113         CDS       T01242                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
ahe  Arcanobacterium haemolyticum
Pathway
ahe00471  D-Glutamine and D-glutamate metabolism
ahe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ahe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Arch_1113
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ahe01011]
    Arch_1113
Enzymes [BR:ahe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     Arch_1113
Peptidoglycan biosynthesis and degradation proteins [BR:ahe01011]
 Precursor biosynthesis
  Racemase
   Arch_1113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: ADH92826
UniProt: D7BPH7
Position
complement(1252484..1253332)
Genome map
AA seq 282 aa AA seqDB search
MGNVRNDAPIGVFDSGIGGLTVARAIIDQLPYESITYVGDTANCPYGPRPIAHVRELALN
VMDHLVSTGVKMLVIACNSASSAVLHDARERYTKQLGIPVVEVIRPAARAALHATRNNKI
GVIATQATIQSGAYDDALAVVPDVNVFSASAPRFVEFAEAGITTGDLVLKTAREYLEPIK
ESGVDTLVLGCTHYPFLSGVIGYVMGEGVLLVSSAEETAKDVYRALTEENLLRSSESGAP
LYSFNVTGESGSFETLARRFIGPKVADVAHVDVPHLHHRCDV
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacgtgcgtaatgatgctccgatcggggtctttgattcaggtattggtggatta
acggtagcgcgtgccattatcgatcagctcccgtacgaatcgatcacgtacgtaggggat
accgccaactgcccatatggcccacgtcctattgctcacgtgcgtgaattggcgttgaac
gtcatggatcatctggtgtctactggcgtgaagatgctggtgattgcgtgcaattcggcg
tcgtctgccgtgcttcatgatgctcgtgaacgttacacaaagcagttggggattcctgtt
gttgaggtgattcggccggctgcgcgtgcggctttgcacgccactcggaacaacaagatt
ggtgtgatcgctacccaggctaccattcaatcgggtgcgtatgatgatgctctggcggta
gtgcctgatgtgaacgtgttttcggcttcagccccacggtttgtggagtttgcggaagcg
ggtattactacgggggatcttgtgctgaaaactgcccgggagtatctggaacctattaag
gaatctggtgtggatacgctggttcttgggtgtacccactatccgttcttgtctggtgtg
attgggtatgtgatgggagagggcgttcttcttgtctcgtctgctgaagaaacagcgaaa
gacgtctaccgtgcgttaactgaagaaaatcttttgcggtcttcggaatctggtgcgccg
ctgtacagcttcaatgtcactggcgaaagtggctcgtttgaaacgttggcacggcgtttc
atcgggccgaaagttgccgacgttgcccatgtggatgttccacaccttcatcatcgttgt
gacgtttag

DBGET integrated database retrieval system