KEGG   Arcanobacterium haemolyticum: Arch_1296Help
Entry
Arch_1296         CDS       T01242                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ahe  Arcanobacterium haemolyticum
Pathway
ahe00020  Citrate cycle (TCA cycle)
ahe00640  Propanoate metabolism
ahe01100  Metabolic pathways
ahe01110  Biosynthesis of secondary metabolites
ahe01120  Microbial metabolism in diverse environments
ahe01130  Biosynthesis of antibiotics
ahe01200  Carbon metabolism
Module
ahe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ahe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ahe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Arch_1296
   00640 Propanoate metabolism
    Arch_1296
   00660 C5-Branched dibasic acid metabolism
    Arch_1296
Enzymes [BR:ahe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Arch_1296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATPgrasp_Ter CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ADH93001
UniProt: D7BK21
Position
complement(1436615..1437787)
Genome map
AA seq 390 aa AA seqDB search
MDLYEYQARELFAKHGVPVVNGIVATTPEEAEQAARQLLEATNLVVVKAQVKTGGRGKAG
GVKLARTPEEAKERAGDILGMDIKGHTVHRVLIASGADITEEYYFSILLDRSERRYLAMC
SKEGGMEIEQLAVERPEALAKVPVNPNVGITEAVAREILTEAGFAPEEHDAIVPVLCRLW
DVYTQEDATLVEVNPLVKTADGSIIAVDGKVTLDDNARIRHPEHAQFVDKQTENPLEARA
KSLGLNYVKLDGGQVGIIGNGAGLVMSTLDVVAYAGEEYGVGPANFLDIGGGANADVMSH
GLDVILNDPDVRSVFVNVFGGITACDEVAKGIVAALDILGDAASKPIVVRLDGNKVAEGR
AILAEAHHPLVTLEPTMDGAAAKAAQFAGK
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
gtggatctctacgagtaccaagcccgcgaacttttcgccaaacacggcgttccagtagta
aatggaatcgtggcaacaacccccgaggaagcggagcaagccgctcgccagctcctagaa
gcaaccaatctcgtcgttgtcaaagctcaagtgaaaactggtggacgcggcaaagcaggc
ggcgtgaaactcgcccgcactccagaagaagctaaagaacgtgccggtgacatcctggga
atggacatcaaggggcacactgttcaccgagtcctcattgccagcggagcagacatcacg
gaagaatactacttctccatcctgcttgatcgttccgaacgccgctaccttgccatgtgt
tccaaagaaggcggcatggaaatcgaacagctcgctgtggaacgtccagaggctttggcg
aaagtgccggtaaacccaaatgtgggaattactgaagcagtagcccgcgaaatccttacc
gaagccgggtttgccccagaagaacacgatgcgatcgtgccagttctgtgccgtctatgg
gatgtttacactcaagaagatgccactcttgttgaagtgaacccgctggtgaaaactgct
gacggcagcatcatcgcggtggacggcaaagtgacgttggatgataacgcccgcatccgc
cacccagagcatgcccagttcgtcgataagcaaacagaaaacccgcttgaagcacgcgcg
aagtcgcttggcctgaactatgtgaaactcgatggcggccaagtgggcatcatcggaaac
ggcgccggacttgttatgtccacactggacgtggtggcatacgctggcgaagaatacggt
gttggcccagcaaacttccttgacattggcggcggtgcaaacgccgacgtcatgtcccac
ggcctcgatgtgatcctcaacgatccagatgttcgctccgtatttgtgaacgtatttggc
ggaattacagcttgtgacgaagttgcaaagggcatcgtggcagcactcgatatcctcggt
gatgcggccagcaagccaatcgtggttcgcctagacggcaacaaggtggccgaaggccgc
gcgatcctggcagaagcacaccatccactcgtcacccttgaaccaacaatggacggggca
gcagccaaggccgcccagttcgccggaaagtga

DBGET integrated database retrieval system