KEGG   Actinoalloteichus hoggarensis: AHOG_13650Help
Entry
AHOG_13650        CDS       T04975                                 

Gene name
gutB
Definition
(GenBank) Sorbitol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ahg  Actinoalloteichus hoggarensis
Pathway
ahg00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ahg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AHOG_13650 (gutB)
Enzymes [BR:ahg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AHOG_13650 (gutB)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AHOG_13650 (gutB)
    1.1.1.-  
     AHOG_13650 (gutB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C DAO Pyr_redox_2 ADH_zinc_N_2 HI0933_like Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ASO20373
UniProt: A0A221W3W7
Position
3131965..3133029
Genome map
AA seq 354 aa AA seqDB search
MTARSTSAPYRHAVVTAPGALEIRTSTSPPEPAPDGVVVAVTYCGVCATDTHAFTSGGLI
PPAVFGHEWAGTVTAVGDDVTGLAVGDRVVAGVGPACGRCAQCRAGHTANCDTVFAEANG
VTPDAPPHGGFATDLAVNARRVVPVLGGISEEQAALVEPTAVTFHAVKRARQPFGALVVV
QGAGPIGLLTAQHARHAGAGVVLVVEPSPGRRATAQALGFTEVYEPGEEFVSRLREITDG
LGADVVYECSGVAGLLQSSAELVRRGGMLALLGYPMTSSEVSYGDWQSRELTVLGSLAYH
HEDFLGAMRSIASGAVRTEELHTGTVGLDDLSRLLTELDSGQSRHAKVLVDPRR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgactgccaggtcgacctcggctccctaccgtcacgccgtcgtcaccgctcccggtgcc
ctcgagatccggacgtccacgagtccgccggaaccggcacccgacggagtggtcgtcgcc
gtcacgtattgcggcgtctgcgcaaccgacacccacgccttcacctcgggcgggctcatc
ccgcctgccgtgttcggacatgagtgggcgggcaccgtgaccgcggtcggcgacgacgtc
accggcctggcggtgggggatcgcgtcgtcgctggggtcggtcccgcctgcggccgctgc
gcgcagtgccgtgccggccacaccgcgaactgcgacaccgtcttcgccgaggccaacggc
gtcacccccgacgctccgccgcacggcggattcgcgaccgatctcgcggtgaacgcccgc
cgagtcgtcccggtactcggcggcatcagcgaggaacaggcggcgctcgtcgagccgacc
gccgtcacctttcacgcggtgaagcgggcccgtcagcccttcggtgcgctcgtggtcgtg
cagggagcgggccccatcggcctgttgaccgcacagcatgcccggcacgccggcgccgga
gtggtgctcgtggtcgagccgtcgccggggcggcgggcgacggcgcaggcgctcggcttc
accgaggtgtacgagccgggggaggagttcgtctcccggctgcgggagatcaccgacggg
ctcggtgcggatgtcgtgtacgagtgcagcggggtggcggggctcctgcagtcctccgcc
gagctcgtgcggcgtggcgggatgctggcgctgttggggtatccgatgacgtcgtccgag
gtcagctacggggactggcagtcgcgtgagctgaccgtgctggggtccctggcctatcac
cacgaggacttcctcggggcgatgcgctccatcgcgagcggggcggtgcggaccgaggag
ctgcacaccgggacggtcgggctggatgacctgtcgcggctgctcaccgaactcgactcg
ggacagagcagacacgccaaggtactggtcgatccgcgtcgctga

DBGET integrated database retrieval system