KEGG   Actinoalloteichus hoggarensis: AHOG_16250Help
Entry
AHOG_16250        CDS       T04975                                 

Gene name
inhA4
Definition
(GenBank) Isonitrile hydratase
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
ahg  Actinoalloteichus hoggarensis
Pathway
ahg00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:ahg00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    AHOG_16250 (inhA4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ahg01002]
    AHOG_16250 (inhA4)
Enzymes [BR:ahg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     AHOG_16250 (inhA4)
Peptidases [BR:ahg01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   AHOG_16250 (inhA4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI Flavodoxin_NdrI
Motif
Other DBs
NCBI-ProteinID: ASO20876
UniProt: A0A221W5D5
Position
3827694..3828413
Genome map
AA seq 239 aa AA seqDB search
MSEQQRTIAMVVYPGLTPLDMVGPLQVLGGLSALDPRFEIAVVGEHTDPMPTDTPLQICA
DRAFDEVPDPFAVIVPGGMAPTMRAMTDERLQEYLRDTAPGARLMGSVCTGSLVLGAAGL
LTGREATSHWAFLPLLAAFGATPVRRRWVTDGPVVTAAGVAAGIDMALHLVSTLAGEDAA
RRVQLVIEYDPEPPLGPLDWETADTAAFSPSMPEYAIREGLGDYPELRERLATQLRAQS
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacaacagcgcaccatcgccatggtcgtgtatccgggactgaccccgttggac
atggtcggtccgcttcaggtgttgggcgggttgtcggcgttggacccgcgattcgagatc
gccgtggtcggcgagcacaccgatccgatgccgaccgacaccccgttgcaaatctgcgcc
gaccgcgccttcgacgaggtccccgaccccttcgcggtgatcgtgcccggcgggatggcg
ccgaccatgcgggcgatgaccgacgagcgacttcaggagtatctgcgggacaccgcgccc
ggcgcgcggctgatgggctcggtgtgcaccgggtcgctggtcctcggggcggcgggcctg
ctcacgggccgagaggcgacgagccactgggcgttcctgccgttgctggccgccttcggc
gcgaccccggtacgccgccgctgggtgacggacggccccgtggtcaccgccgccggggtc
gccgcgggcatcgacatggccctgcacctggtgtcgacgctcgcaggggaggacgcggcc
cgccgggtccagctcgtcatcgagtacgacccggagccgccgctgggcccgctggactgg
gagaccgccgacacggcggcgttctctccctcgatgcccgagtacgcgatccgagagggc
ctcggggactacccggagctgcgggagcggctggccacgcagctgcgcgcccagagctga

DBGET integrated database retrieval system