KEGG   Actinoalloteichus hoggarensis: AHOG_27605Help
Entry
AHOG_27605        CDS       T04975                                 

Gene name
pdhC2
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ahg  Actinoalloteichus hoggarensis
Pathway
ahg00010  Glycolysis / Gluconeogenesis
ahg00020  Citrate cycle (TCA cycle)
ahg00620  Pyruvate metabolism
ahg01100  Metabolic pathways
ahg01110  Biosynthesis of secondary metabolites
ahg01120  Microbial metabolism in diverse environments
ahg01130  Biosynthesis of antibiotics
ahg01200  Carbon metabolism
Module
ahg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ahg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AHOG_27605 (pdhC2)
   00020 Citrate cycle (TCA cycle)
    AHOG_27605 (pdhC2)
   00620 Pyruvate metabolism
    AHOG_27605 (pdhC2)
Enzymes [BR:ahg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AHOG_27605 (pdhC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF3248
Motif
Other DBs
NCBI-ProteinID: ASO23118
UniProt: A0A221WAK7
Position
6509639..6511024
Genome map
AA seq 461 aa AA seqDB search
MPRLKHFPLPDTGEGLTEAEIITWHVAAGDTVTVNQIIVEIETAKAVVELPCPFAGQVSQ
LLVEVGETVEVGVPIIAIDVDPHGSADGESTDEQAVNGAKPAEAEGRVSNLVGYGPRTGA
ATRRPRKKSGASAPQAAPPAPVPQPVAAVPATPAPKPAAPAAMPAGGAQPRTTGRVPLAK
PPVRKLAKDAGIDLRTIVGSGANGVITREDVTGAVAAAAVPATPTRGQPAREERVPIRGV
RRATAQAMVQSAFTAPHVTEFLTVDVTPMMELRARLKTHPEFQGVKITPLAFAAKALCLA
VRRTPDVNATWDEQAGEIVYKSYVHLGIAAATPRGLVVPKVREAQDMSLRELAEALDALA
TTAREGRTTPADMVDGTITITNVGVFGVDTGTPILNPGESAILALGAIRDMPWVVDGQVV
PRKVCQLALSFDHRVVDGQQGSRFLADIGALLADPGLAMTY
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgccacgactgaagcacttcccgctgccggacaccggcgagggactcaccgaagcggag
atcatcacctggcacgtcgccgcgggcgacacggtgacggtcaaccagatcatcgtcgag
atcgagacggcgaaggccgtggtcgagctgccctgcccgttcgcggggcaggtgtcgcaa
ctgctggtcgaggtcggcgagaccgtcgaggtcggcgtgccgatcatcgccatcgacgtc
gatccgcacggctcggcggacggggaatcgacagacgagcaggccgtcaacggcgcgaag
cccgccgaggcggagggccgggtgtcgaacctggtcggatacgggcctcgtaccggggcg
gcgacgcgcaggccccgcaagaagtccggtgcctcggcaccgcaggcggcaccgcccgcg
cccgttccccagccggtggcggccgtgcccgccacacccgcccccaagcctgcggctccg
gcggcgatgcctgcgggcggtgcgcagcctcgcaccaccggacgggtgccgctcgccaag
cccccggtgcgcaaactcgccaaggacgcgggcatcgacctccgcaccatcgtcggcagc
ggcgcgaacggcgtgatcacccgcgaggacgtcaccggcgccgtcgcggcggcagcggtt
ccggccacgccgacgcgggggcagcctgcccgcgaggagcgggtgccgatccgcggcgtg
cgacgtgccaccgcccaggccatggtgcagagcgccttcaccgcgccgcacgtcacggag
ttcctcaccgtcgacgtcacgccgatgatggagctgcgggccagactgaagacgcatccg
gagttccagggcgtgaagatcacgccgttggccttcgccgcgaaggcgctgtgtctcgcg
gtgcgtcggacgccggacgtcaacgcgacctgggacgagcaggcaggcgagatcgtctac
aagtcctacgtgcacctgggcatcgccgcggccaccccgcgtgggctggtcgtgccgaag
gtgcgtgaggcgcaggacatgtcgctgcgtgagctggccgaggcgctggacgcgctggcc
acgaccgcgcgggagggtcgcaccaccccggcggacatggtcgacggcaccatcaccatc
accaacgtcggggtgttcggcgtcgacaccgggacgcccatcctgaatccgggcgagtcg
gcgatcctggcgctgggcgccattcgcgacatgccgtgggtggtcgacggccaggtcgtg
ccgcgcaaggtgtgtcagctggcgttgagcttcgatcaccgggtggtcgacggccagcag
ggctcgcggttcctcgccgacatcggggcgctgctcgccgatcccggcctggcgatgacc
tactga

DBGET integrated database retrieval system