KEGG   Aeromonas hydrophila AL06-06: RY45_01820Help
Entry
RY45_01820        CDS       T03748                                 

Gene name
ompR
Definition
(GenBank) osmolarity response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
ahh  Aeromonas hydrophila AL06-06
Pathway
ahh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ahh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RY45_01820 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ahh02022]
    RY45_01820 (ompR)
Two-component system [BR:ahh02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   RY45_01820 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: AJQ52878
UniProt: A0A0F6KJZ5
Position
368551..369270
Genome map
AA seq 239 aa AA seqDB search
MSQQYKVLVVDDDLKLRSLLERYLTEQGFVVRGVANGEQADRLLTRENFSLMVLDLMLPG
EDGLSICRRLREAGNQIPVLMLTAKGDEVDRIVGLEMGADDYLPKPFNPRELLARIRAVL
RRHTVELPGAPSTAEKVVSFGSYQLNLATRELSRDGDPVALTSGEFAVLKVLVSHPREPL
SRDKLMNLARGREYTATERSIDVQVSRLRRLLEQDPAQPRYLQTVWGLGYVFVPDGDGE
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagcaatacaaggttctggtcgtcgacgatgatttgaaattacgttccctgctg
gagcgctacctgaccgaacaggggttcgtggttcggggcgtcgccaatggcgaacaggcc
gaccgcctgctgacccgtgagaacttcagcctgatggtgctggatctgatgctgccgggg
gaagacggcctctccatctgccgccgcctgcgcgaggccggcaaccagatcccggtgctg
atgttgaccgccaagggggatgaggtggatcgcattgtcgggctcgagatgggggccgat
gattacctgcccaagccgttcaacccccgtgagctgctggcccggatccgcgccgtgctg
cgccggcacaccgtcgagttgccgggggccccctctaccgccgagaaggtagtgagcttt
ggcagctaccagctcaacctggcgacccgcgagctgagccgcgatggtgacccggttgcg
ctgaccagcggtgaattcgccgtgctcaaggtgctggtgagccatccgcgcgagcctctc
tcccgcgacaagctgatgaacctggcccgcggtcgcgaatataccgccaccgagcgcagc
atcgacgtgcaggtctcccgcctgcgtcgcctgctggagcaggatccggcgcagccccgt
tatctgcagaccgtctggggtctgggctatgtgttcgtgccggacggtgacggcgaatga

DBGET integrated database retrieval system