KEGG   Aeromonas hydrophila AL06-06: RY45_05405Help
Entry
RY45_05405        CDS       T03748                                 

Definition
(GenBank) SAM-dependent methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
ahh  Aeromonas hydrophila AL06-06
Brite
KEGG Orthology (KO) [BR:ahh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ahh03009]
    RY45_05405
Enzymes [BR:ahh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     RY45_05405
Ribosome biogenesis [BR:ahh03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    RY45_05405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_23 Methyltransf_31 MTS
Motif
Other DBs
NCBI-ProteinID: AJQ53551
Position
complement(1135221..1136021)
Genome map
AA seq 266 aa AA seqDB search
MHLQCPICRSPLQLHEASRGVYCANKHHFDPAPEGYLDLIPGIKNPKDSDSRALLRAKRR
FLEQGHQLPAVEAMAALLAPLGVHELIHLGCGEGYYCRALAERLPGWRVGGFDLAKNAIF
AANKAQPDGQFVIADPARAPLQPGTAQVLLVNDLKVKTEQLVGWLAPGGYLLYLQPGPRH
QWQLRVSLNPVSMEHPLSWPSLAGLNPMGQLRCQFSMQMDQGLRSFILETSRLGWRASGE
QRHAFSHQGPDELEQDLLLSLWQKPL
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgcacctgcaatgccctatctgtcgcagcccgctgcaacttcatgaagcctcccgcggg
gtctactgcgccaacaagcaccatttcgatcccgctccggaaggctatctggatctcatc
cccggcatcaagaacccgaaagacagcgacagccgcgccctgctgcgcgccaagcgccgc
ttcctggagcagggccaccagctgcccgcggtggaggccatggccgccctgctggccccg
ctcggcgttcatgagctgatccacctcggctgtggcgaaggctactactgtcgcgccctg
gccgagcgcctgcccggctggcgcgtcggcggcttcgatctggccaagaacgccatcttc
gccgccaacaaggcgcagccggacggccagttcgtcatcgccgatccggcccgcgccccg
ctgcagccgggcaccgcccaggtgctgctggtcaacgacctcaaggtcaagaccgagcag
ctggtcggctggctggcaccgggcggctacctgctctacctgcagccgggcccccgccac
cagtggcagctgagggtcagcctcaacccggtcagcatggagcacccgctgagctggccg
agcctggccggcctcaaccccatgggtcagctgcgctgccagttcagcatgcagatggac
caggggctgcgcagcttcatcctggagaccagccgcctcggctggcgcgccagcggcgaa
cagcgccacgccttcagccaccagggaccggacgagctcgagcaggatctgctgctgagc
ctgtggcagaagccgctctga

DBGET integrated database retrieval system