KEGG   Aeromonas hydrophila AL06-06: RY45_09385Help
Entry
RY45_09385        CDS       T03748                                 

Gene name
gcvT
Definition
(GenBank) glycine cleavage system protein T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
ahh  Aeromonas hydrophila AL06-06
Pathway
ahh00260  Glycine, serine and threonine metabolism
ahh00630  Glyoxylate and dicarboxylate metabolism
ahh00670  One carbon pool by folate
ahh01100  Metabolic pathways
ahh01110  Biosynthesis of secondary metabolites
ahh01130  Biosynthesis of antibiotics
ahh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ahh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RY45_09385 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RY45_09385 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    RY45_09385 (gcvT)
Enzymes [BR:ahh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     RY45_09385 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C POPLD
Motif
Other DBs
NCBI-ProteinID: AJQ54286
Position
2023271..2024368
Genome map
AA seq 365 aa AA seqDB search
MIQTTVLHPKHLEAGAKMVDFHGWEMPINYGSQLEEHHQVRTDAGMFDVSHMTIVDLTGE
RVKAFLQHLLANDVAKLTVFGKALYSGMLTPEGGVIDDLITYYLGETFYRLVVNSATREK
DLAWIRHHAQDFGVTVTERPELAMIAVQGPNAKAKAAKVFSAEQNAAVEGMKPFFGVQAG
ELFIATTGYTGEDGYEIVVPQAQACDLWQALLDNGVAPCGLGARDTLRLEAGMNLYGQDM
DETVSPLAANMAWTIAWEPSDRQFIGRAALEAQKAAGSQPKLVGLVMEEKGVLRSGMPVT
FTTAAGEEREGVITSGSFSPTLGYSIALARVPRDIGEQASVEIRKKLVTVKVTKPAFVRN
GQKLV
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgatccagactacagtactgcatcccaagcacctggaagccggcgccaagatggtggac
ttccacggttgggaaatgcccatcaactacggctcacagctggaagagcaccatcaggtg
cgcaccgatgccggcatgttcgacgtctcccacatgaccatcgtcgatttgaccggcgag
cgggtcaaagccttcctgcaacacctgctggccaacgacgtggccaagctcaccgtcttc
ggcaaggccctctacagcggcatgttgaccccggaaggcggtgtcatcgatgacctcatc
acctattaccttggcgagaccttctaccgcctggtggtcaactccgccacccgcgagaag
gatctggcctggatccgccaccacgcccaggacttcggggtgaccgtgaccgagcgcccc
gagctcgccatgatcgcggtgcagggccccaacgccaaggccaaggcggccaaggtgttc
agcgccgagcaaaatgccgcagtggaaggcatgaagcccttcttcggcgtgcaggccggc
gagctcttcatcgccactaccggctacaccggtgaagacggctacgagatcgtggtgccg
caagcgcaggcgtgcgatctgtggcaggcgctgctggacaacggcgtggccccctgcggc
ctgggtgcccgcgacaccctgcgcctcgaggccggcatgaacctctacggccaggacatg
gacgaaaccgtctctccccttgccgccaacatggcttggaccatcgcctgggaaccgagc
gatcgccagttcatcggccgcgccgcgctggaagcccagaaagccgccggcagccagccc
aagctggtgggtctggtgatggaagagaagggtgtgctgcgcagcggcatgccggtcacc
ttcaccaccgccgctggagaagagcgggaaggtgtgatcacctccggctctttctcgccc
accctggggtacagtattgcgttggcgcgggtgccccgtgatatcggcgaacaggcctcg
gtggagatccgcaagaagctggtcactgtcaaagtgaccaagccggctttcgtgcgcaac
ggccagaagctggtgtaa

DBGET integrated database retrieval system