KEGG   Aeromonas hydrophila AL06-06: RY45_11690Help
Entry
RY45_11690        CDS       T03748                                 

Gene name
metG
Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ahh  Aeromonas hydrophila AL06-06
Pathway
ahh00450  Selenocompound metabolism
ahh00970  Aminoacyl-tRNA biosynthesis
ahh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ahh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    RY45_11690 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RY45_11690 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ahh01007]
    RY45_11690 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ahh03016]
    RY45_11690 (metG)
Enzymes [BR:ahh01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     RY45_11690 (metG)
Amino acid related enzymes [BR:ahh01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   RY45_11690 (metG)
Transfer RNA biogenesis [BR:ahh03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    RY45_11690 (metG)
 Prokaryotic type
   Other AARSs
    RY45_11690 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 DALR_1
Motif
Other DBs
NCBI-ProteinID: AJQ54710
Position
2548520..2550553
Genome map
AA seq 677 aa AA seqDB search
MATDPRTMLVTCALPYANGSIHLGHMLEHIQADIWVRYQRMRGHQVHFVCADDAHGTPIM
LKAQQLGITPEEMIAAVSKEHQADFAGFNISFDNYHSTHSDENRELAELIYGRLQAGGKI
KSRTISQLFDPEKSMFLPDRFVKGTCPKCKSPEQYGDNCDSCGATYSPTELIDPKSAVSG
ATPVMKDSEHFFFDLPQFEKWLAEWVRGSGAIQEEMANKMQEWFESGLQQWDITRDAPYF
GFEIPGAPGKYFYVWLDAPIGYMASFKNLCNKRGDIDFDSYWKADSEAELYHFIGKDIAY
FHCLFWPSMLEGAGFRKPTKVNVHGYVTVNGAKMSKSKGTFIKASTYLNHLDPECLRYYY
AAKLNSRIDDLDLNLDDFVARVNADVVNKLVNLASRNAGFIAKRFDGKLAATCAEPELYA
EFANARSAIAEAYESREFSRAIREIMALADKANRYVDDKAPWVIAKQEGADAELQAVCSV
GINLFRVLMAYLKPVMPLLAERAEAFLGETLSWDGVAQPLTNHQLAPFKALFSRIEPAKI
EAMIEASKEDLAKEQAPKASGPLVDDPISETISYDDFAKIDLRVALIKKAEAVPEADKLL
KLQLDIGGETRQVFAGIKSAYNPEDLEGKLTVMVANLAPRKMRFGMSEGMVLAAGPGGKD
LWILEPQEGAQPGMRVK
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgatcctcgtacaatgctggtaacctgcgcccttccctatgccaatggctcc
atccatcttggccacatgctggaacacatccaggccgatatctgggttcgttatcagcga
atgcgcggtcaccaggtgcactttgtctgtgccgacgatgcccacggcaccccgatcatg
ctcaaggcccaacagctggggatcaccccggaagagatgatcgcggccgtctccaaggag
caccaggccgacttcgccgggttcaacatcagttttgacaactatcactccacccacagc
gacgagaaccgcgagctggcggagctgatctacggccgtctgcaggccggcggcaagatc
aagagccgcaccatctcccagctgttcgatccggaaaagtccatgttcctgccggaccgc
ttcgtcaagggcacctgccccaagtgcaagtctccggagcagtatggcgacaactgtgac
agctgcggcgcgacctacagcccgaccgagctgattgatccgaaatccgccgtctccggc
gccaccccggtgatgaaggactccgagcacttcttcttcgacctgccgcagtttgaaaaa
tggctggcagagtgggtgcgcggctccggcgccatccaggaagaaatggccaacaagatg
caggagtggttcgaaagcggcctgcagcagtgggacatcacccgtgacgccccctacttc
gggttcgaaattcccggcgccccgggcaagtacttctacgtctggctggacgcccccatc
ggttacatggcgtcgttcaagaacctgtgcaacaagcgcggcgacatcgatttcgacagc
tactggaaggcggactccgaggccgagctctaccacttcatcggcaaggacatcgcctac
ttccactgcctgttctggccgtccatgctggaaggcgccggtttccgcaagccgaccaag
gtcaatgtgcacggctacgtgaccgtcaacggtgccaagatgtccaagtccaagggcacc
ttcatcaaggcttccacctatctcaaccatctggatccggagtgcctgcgttactactac
gccgccaagctcaacagccgcatcgacgatctggacttgaacctcgatgacttcgtcgcc
cgcgtcaacgccgacgtggtcaacaagctggtcaacctcgcttcccgcaacgccggtttc
atcgccaagcgtttcgacggcaagctggccgccacctgcgccgagcccgagctctacgcc
gagttcgccaacgcccgctctgccatcgccgaggcctacgagagccgcgagttcagccgc
gccatccgcgagatcatggcgctggccgacaaggccaaccgctacgtggatgacaaggct
ccctgggtcatcgccaagcaggaaggcgctgacgccgagctgcaggcggtctgctccgtc
ggcatcaacctgttccgggtgctgatggcctacctcaagccggtgatgccgctgctggcc
gagcgcgccgaagccttcctgggggaaaccctcagctgggacggtgtcgcccagccgcta
accaaccatcagctggccccgttcaaggcgctgttctcccgcatcgaaccggccaagatt
gaagccatgatcgaagcatccaaggaagatctggccaaagagcaggcaccgaaagcgagc
ggcccgctggtagacgatcccatcagcgagaccatcagctatgacgacttcgccaagatt
gacctgcgcgtagccctgatcaagaaggccgaagcagtaccggaagcggacaaactgctc
aagctgcagctggatatcggcggtgagacccgccaggtgtttgccggcatcaagtccgcc
tacaacccggaagatctggaaggcaagctgaccgtgatggtggccaacctggccccgcgc
aagatgcgtttcggcatgtccgaaggcatggtgcttgcggcaggtccgggcggcaaggat
ctctggatcctggagccgcaagaaggcgcccagcccggcatgcgcgtcaagtaa

DBGET integrated database retrieval system