KEGG   Aeromonas hydrophila AL06-06: RY45_11945
Entry
RY45_11945        CDS       T03748                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
ahh  Aeromonas hydrophila AL06-06
Pathway
ahh00230  Purine metabolism
ahh01100  Metabolic pathways
ahh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ahh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    RY45_11945
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AJQ54759
Position
complement(2614510..2614995)
AA seq 161 aa
MMQPQSCPAVEIQCEINGKPYSYAVSPTMSLLHFLRGQGLISVKEGCSVGECGACTVRVD
GTAIDSCLYLAVWADGKSIRTVEGERQGNELSDVQQAFIDEGAVQCGFCTPGLVMASAAL
LDKTERRPLTDAEIRRGLSGNLCRCTGYQNVVRAVKKCCKG
NT seq 486 nt   +upstreamnt  +downstreamnt
atgatgcaaccgcaaagctgtcccgctgtggagatccagtgcgagatcaacggcaagcct
tactcctatgctgtgtcgcccaccatgtcgctgcttcatttcctgcgcgggcaggggctc
atcagcgtgaaagaggggtgcagtgtcggtgagtgcggcgcctgtaccgtgcgggtggat
ggcaccgccatcgacagctgcctctatctggcggtgtgggccgatggcaaatccattcgc
accgtggagggagagcggcagggcaatgagctctccgacgtgcagcaggccttcatcgac
gagggggcggtgcagtgcggtttttgcaccccgggattggtgatggcgagcgcggccctg
ctcgacaagacagagcgccgtccgctgaccgatgcggagatccgccgcggcctgtcgggg
aatctgtgccgctgcaccggctaccagaacgtggtgcgggcggtgaagaagtgctgcaag
gggtga

DBGET integrated database retrieval system