KEGG   Aeromonas hydrophila AL06-06: RY45_11955
Entry
RY45_11955        CDS       T03748                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
ahh  Aeromonas hydrophila AL06-06
Pathway
ahh00230  Purine metabolism
ahh01100  Metabolic pathways
ahh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ahh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    RY45_11955
Enzymes [BR:ahh01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     RY45_11955
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AJQ54761
Position
complement(2615863..2618181)
AA seq 772 aa
MSIGLPLKRVDAEAKVTGSARYTDDNIMLGMRHAKYVRSHIAHGKVLTIDASEALALHGV
EAVFTHEDVPTTCFRTAGHAWSLDEAKRDVKDRRLLTDHVRHFGDGVAIVVARDPLVAEK
AAALVKVIYEPLPVMTDAASALAEGACPIHPTGNLLRQSQIRAGEPEQAIAAADLQFKGH
YQTPVVQHCHLETVTCYAYMDQPDHIIVVTSTQIPQIVRSRVAKSLGLPWSSVRVIKPYM
GGGFGNKQDVLEEPMAAFLSYKLGGVPVKVTLSREECFFASRTRHGFAIDGTLGINRDGV
LKGYQLDVLSNTGGYASHGHSIASAGANKISYLYPRSAFGYDAKTFYSNLPTAGAMRGYG
APQVVFALECMLDDACAELGLDPLAVRIANVAREGDVNQVNQKTIYSAGLPECLRRGGEQ
FEWERLKAECLAQDPASRVRRGIGVACFSYGSNTYPVGVEIAGARMLLNQDGTVNLQIGA
TEIGQGSDTVFAQMAAQTLGIPFEQIRVISTQDTDITAYDPGSFASRQSYVAAPAIHQAA
LQLRARILSLAAQLCHQDVGSLTLIDGYVVLAGAPDKVLISVAEVSVNAYYHLTIGGQIT
SEVSHKTTTNPPSFGCTFVDLSVDINLCKVTINRILNLHDAGKILNPQLAEGQVHGGMGM
GIGWSLFEEMIIDAKTGVVRNPNLLDYKFPTMLDLPELECDFVQTYEPQSVYGHKSLGEP
PIISPGPAIRNAIRMATGVAINELPITPKTLFREFVAAGLIGEGAGEEQHHV
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgtccataggattaccgctcaagcgggtggatgccgaggccaaggtgaccggcagcgcc
cgctacaccgacgacaacatcatgctcggcatgcgccacgccaagtacgtgcgaagccat
atcgcccacggcaaggtgctcaccatcgacgccagcgaggcgctggcgctgcacggggtc
gaagccgtgttcacccacgaggatgtgcccaccacctgttttcgcaccgccggtcacgcc
tggtccctcgatgaggccaaacgggacgtgaaagaccggcgtctgctcaccgaccatgtg
cgccactttggcgatggggtcgccatcgtggtggcccgcgatcccctggtcgccgagaag
gctgccgccctggtcaaggtgatctacgagccgctgccggtgatgacggatgcggccagc
gccctggccgagggcgcctgtcccatccacccgaccggcaacctgctgcgccagagccag
atccgggcgggtgagccggagcaggccatcgccgccgccgacttgcagttcaaggggcac
taccagacgccggtggtgcagcactgccatctggagacggtgacctgctacgcctacatg
gatcagccggatcacatcatcgtcgtcaccagcacccagatcccccagattgtgcgcagc
cgggtggccaaatccctcggcctgccctggtcgagcgtgcgggtgatcaagccctacatg
ggcggcggttttggcaacaagcaggatgtgctggaagagccgatggcggcgtttctgagc
tacaagctcggcggcgtgccagtcaaggtgaccttgagccgggaagagtgcttctttgct
tcccgcacccgccacggctttgccatcgacggcaccctaggtatcaaccgggatggcgtg
ctcaaggggtatcagctggacgtgctctccaataccggcggctatgcctcccacggccac
tccatcgccagcgccggcgccaacaagataagctacctctatccgcgcagtgcctttggc
tacgacgccaaaaccttctacagcaacctgcccaccgccggtgccatgcgcggttacggc
gcgccccaggtggtgtttgccctcgaatgcatgctggacgatgcctgcgccgagctggga
ctcgacccgcttgcggtgcggatcgccaacgtggcgcgcgaaggggacgtcaatcaggtc
aaccagaagaccatctacagtgcgggcttgcccgagtgtctgcgccggggcggcgagcag
ttcgagtgggagcggctcaaggccgagtgtctggcgcaggatccggcgagccgggtgcgc
cgtggcatcggggtggcgtgctttagctacggctccaacacctacccggtgggggtcgaa
attgccggcgcccgcatgctgctcaatcaggatggcaccgtcaatttgcagataggtgcc
accgagatagggcaggggtcggataccgtctttgcccagatggcggcccagacgttaggc
attccatttgagcagatccgggtcatttcgactcaggataccgacatcaccgcctacgac
cctggctcgttcgcctcgcgccagagctatgtggcggcccccgccatccatcaggcggcg
ctgcagttgcgggcccgcattttgtcgctggcagcccagctctgccatcaggatgtgggg
tcgctcaccctgatcgatggctatgtagtgttggccggtgcaccggacaaggtgctcatc
agcgtcgccgaggtatcggtcaacgcctattaccacctcaccatcggcggccagatcacc
tcggaagtctcccacaagaccaccaccaacccgccgagctttggctgcaccttcgtcgat
ctcagcgtcgacatcaatctctgcaaggtgaccatcaatcgcatcctcaacttgcacgat
gccggcaagatcctcaacccgcagttggcagagggacaggtgcacggcggcatggggatg
gggatcggctggtcgctgttcgaggagatgatcatcgacgccaagaccggcgtggtgcgc
aaccccaacctgctcgactacaagttccccaccatgctggatttgccagagcttgagtgc
gacttcgtgcagacctatgagccccagtcggtctatggccacaaatctctgggggaaccg
cccatcatctcgccgggcccggcgatccgtaacgccattcgcatggcgaccggggtcgcg
atcaacgagctgcccatcacccccaagactctgttccgggagtttgtcgcggcgggtttg
attggcgagggagcaggggaggagcaacaccatgtttga

DBGET integrated database retrieval system