KEGG   Aeromonas hydrophila AL06-06: RY45_17805Help
Entry
RY45_17805        CDS       T03748                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
ahh  Aeromonas hydrophila AL06-06
Pathway
ahh00564  Glycerophospholipid metabolism
ahh01100  Metabolic pathways
ahh01110  Biosynthesis of secondary metabolites
Module
ahh_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:ahh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    RY45_17805
Enzymes [BR:ahh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     RY45_17805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AJQ55845
UniProt: A0A347A2G7
Position
3956830..3957702
Genome map
AA seq 290 aa AA seqDB search
MSITDNLKIAGQYCLPKHALSRLVGKLAAAEAGNLTTRVIEAFIKQYQVDMSEALHESPA
HYKSFNEFFTRELKPGIRPLVEDAMTLALPVDGTVSQLGPIQQGRIIQAKGHDYSARELL
GGYEDLVAPFKDGDFATIYLAPKDYHRIHMPLDGVLESMVFVPGDLFSVNPLTAENVPNL
FARNERVVATFRTPHGPMALVLVGATIVASIETIWAGNIAPTKEKRVVRWDYSGDEAITL
QKGAEMGLFKLGSTVVCLFGPGMLAGFEPHLANGVTTRMGQPFAKLAAQA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgagcattactgacaacctgaaaattgccggtcaatactgtctgcccaaacacgccctc
tcccgcctggtcggcaaacttgcggcagccgaagcaggcaacctcaccaccagggtgatc
gaggcctttatcaagcagtaccaggtcgacatgagcgaggcgctgcacgagagtccggcc
cactacaagagcttcaacgaattcttcacccgcgaactcaagccggggatccgccccctg
gtcgaggatgccatgaccctggcgctgccggtggatggtaccgtcagccagctcggtccg
atccagcagggccgcatcatccaggccaagggccacgactacagcgcccgtgagctgctg
ggcggttatgaggatctggtggcgccgttcaaggatggcgacttcgccaccatctacctg
gcgcccaaggattatcaccgcatccacatgccgctggacggcgtgctggagagcatggtg
ttcgtgccaggggatctcttctccgtcaacccgctcaccgccgagaacgtgcccaacctg
tttgcccgcaacgagcgggtggtcgccaccttccgcaccccgcacggccccatggcgctg
gtgctggtcggtgccactatcgtggccagcatcgagaccatctgggccggcaacatagcg
ccgaccaaagagaagcgcgtcgtgcgctgggattacagcggcgacgaagccatcaccctg
caaaaaggcgccgagatgggcctgttcaagctgggcagtaccgtggtctgtctgtttggc
ccggggatgctggccggtttcgagccccatctggccaacggggttaccacccgcatgggc
cagccctttgccaagctggcggcgcaggcatga

DBGET integrated database retrieval system