KEGG   Aeromonas hydrophila AL06-06: RY45_18415Help
Entry
RY45_18415        CDS       T03748                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
ahh  Aeromonas hydrophila AL06-06
Pathway
ahh00430  Taurine and hypotaurine metabolism
ahh00620  Pyruvate metabolism
ahh00640  Propanoate metabolism
ahh00680  Methane metabolism
ahh01100  Metabolic pathways
ahh01120  Microbial metabolism in diverse environments
ahh01200  Carbon metabolism
Module
ahh_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:ahh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RY45_18415
   00640 Propanoate metabolism
    RY45_18415
  09102 Energy metabolism
   00680 Methane metabolism
    RY45_18415
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    RY45_18415
Enzymes [BR:ahh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     RY45_18415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AJQ55956
Position
complement(4094839..4096038)
Genome map
AA seq 399 aa AA seqDB search
MSKLVLILNCGSSSLKFAVMDAETGEDMLSGLAECFNLDDARIKWKLHGVKGEAMLGAGA
AHQEALDHIVGHILPQDPTLAEQLVAIGHRIVHGGEQFSRSVRIDDGVIAGIEAAIPFAP
LHNPAHLIGIRAALKVFPALAEKNVAVFDTAFHQTLPEEAYLYALPYKLYKENGIRRYGA
HGTSHRFIAEEAAKALGKPLSELNIINCHLGNGASVCAIRGGESVDTSMGLTPLEGLAMG
TRSGDIDPAVVFFMHDQLGYSVEQINHTLTRESGLLGMTEASSDCRYVTTNYATDAGAKR
ALDVFTYRVAKYVGAYAAAMDGRLDALVFTGGIGENAAMVREMVLARLALFGFKIDKEAN
NAAVLGGEGPITAEGSRLALVMPTNEELVIARDALSLVG
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagttggtattgatccttaactgcggtagctcttccctgaaatttgccgtaatg
gacgccgaaacaggtgaggacatgctgtccggcctggccgaatgcttcaatctggatgat
gcacgtatcaaatggaaactccacggggtcaagggcgaagccatgcttggcgcgggcgcc
gcgcaccaggaggccctcgaccacatcgtaggtcacatcctgccgcaggatccgaccctg
gccgagcagctggtggccatcggtcaccgcatcgtgcacggtggcgagcagttctcccgt
tccgttcgcatcgatgacggcgtgattgccggcatcgaagccgccattccgttcgccccc
ctgcacaacccggcgcacctgatcggcatccgtgccgcgctcaaggtgttcccggcgctg
gcagagaagaacgtggccgtgttcgacaccgccttccaccagaccctgccagaggaagcc
tacctctacgcgctgccctacaagctctacaaagagaacggcatccgtcgttacggcgcc
cacggcacctcccaccgcttcatcgcggaagaggccgccaaggcgctgggcaagccgctc
tccgagctcaacatcatcaactgccacctgggtaacggcgcctccgtctgcgccatccgt
ggcggcgaatccgtcgacacctccatgggcctgaccccgctggaagggctggcgatgggc
acccgctccggcgacatagaccccgctgtagtcttcttcatgcacgaccagctcggttac
agcgtggagcagatcaaccacaccctgacccgcgagtccggcctgctgggcatgaccgag
gcgagcagcgactgccgctatgtcaccaccaactacgccaccgacgccggtgccaagcgc
gcgctggacgtgttcacctaccgggtggccaagtatgtcggcgcctacgctgccgccatg
gatggtcgtctggacgccctggtgttcactggtggcatcggtgaaaacgccgccatggtg
cgcgagatggtgctggcccgtctggccctgttcggcttcaagatcgacaaggaagccaac
aacgccgcggtactgggcggtgaaggccccatcaccgccgaaggcagccgcctggcgctg
gtgatgcccaccaacgaagagctggtcatcgcccgcgatgccctgagcctggtcggctaa

DBGET integrated database retrieval system