KEGG   Aeromonas hydrophila AL06-06: RY45_19485Help
Entry
RY45_19485        CDS       T03748                                 

Definition
(GenBank) heptose 1-phosphate adenyltransferase
  KO
K03272  D-beta-D-heptose 7-phosphate kinase / D-beta-D-heptose 1-phosphate adenosyltransferase [EC:2.7.1.167 2.7.7.70]
Organism
ahh  Aeromonas hydrophila AL06-06
Pathway
ahh00540  Lipopolysaccharide biosynthesis
ahh01100  Metabolic pathways
Module
ahh_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:ahh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    RY45_19485
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ahh01005]
    RY45_19485
Enzymes [BR:ahh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.167  D-glycero-beta-D-manno-heptose-7-phosphate kinase
     RY45_19485
   2.7.7  Nucleotidyltransferases
    2.7.7.70  D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase
     RY45_19485
Lipopolysaccharide biosynthesis proteins [BR:ahh01005]
 Unusual sugar
  RY45_19485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB CTP_transf_like Phos_pyr_kin Carb_kinase SPDY FAD_syn
Motif
Other DBs
NCBI-ProteinID: AJQ56142
UniProt: A0A347A1P3
Position
complement(4298467..4299894)
Genome map
AA seq 475 aa AA seqDB search
MKITLPEFEKARVLVVGDVMLDRYWHGPTGRISPEAPVPVVKVEHIEERPGGAANVALNS
AALGAHAVLLGLTGQDEAADALAGQMAGVKVACDFVRLADYPTITKLRVLSRNQQLLRLD
FEEAFHDVDSTLLMGKVEQALPHSDVMILSDYGKGALNDVPGMIQRARAAGIPVLVDPKG
TDFEKYRGATLLTPNMSEFEAVVGKVKSEEELVAKGLELVKRFELEALLVTRSENGMTLI
REGQPELHLPAQAHEVYDVTGAGDTVISTLATSLAAGKSLDEACALANTAAGIVVGKLGT
STVSPVELANALYTEQETGFGVMSEAQLKIAVQAARLRGEKVVMTNGCFDILHAGHVSYL
ANAGKLGDRLIVAVNTDESVRRLKGPGRPVNPTERRMAVLAALGAVDWVVPFSEDTPQRL
IAEVLPDLLVKGGDYKPEEIAGYAEVTANGGEVRVLNFEDGCSTSDIIKTIRERG
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcaccctgcccgagtttgaaaaagcccgcgttctggtcgttggcgatgtcatg
ttggaccgttattggcatggccccaccggccggatctcgcccgaggcaccggtgcccgtg
gtcaaggtcgaacacattgaggagcgcccgggtggcgccgccaacgtggcgctcaactcc
gccgcgctgggcgcccacgccgtgctgctgggtctgaccggtcaggatgaggccgccgat
gccctggctggccagatggccggcgtcaaggtcgcctgtgacttcgttcgtctggccgac
tacccgaccatcaccaagctgcgcgtgctgtcgcgcaaccagcagctgctgcgtctggac
tttgaagaggccttccacgatgtggactccaccctgctgatgggcaaggtcgagcaggcg
ctgccgcacagcgacgtgatgatcctctccgactacggcaagggtgccctcaacgacgtg
cccggcatgatccagcgcgcccgcgccgccggcatcccggtgctggtcgatcccaagggg
accgatttcgagaagtaccgcggcgctaccctgctgacccccaacatgtccgagttcgag
gccgtggtgggcaaggtgaagagcgaagaggagctggttgccaaggggctggagctggtc
aagcgcttcgagctggaggccctgctggtcacccgttccgagaacggcatgaccctgatc
cgcgaaggccaacccgagctgcacctgccggcccaggcccacgaggtgtatgacgtgacc
ggtgccggtgataccgtcatctccaccctggccacctcgctggccgccggcaagagcctg
gacgaagcctgtgccctggccaacaccgccgctggtatcgtggtcggcaagctggggacc
tccaccgtcagcccggttgagctggccaacgccctctacaccgagcaggagaccggcttt
ggcgtcatgtccgaagcccagctcaagattgccgtgcaggccgcccgtctgcgtggcgag
aaggtggtgatgaccaacggctgcttcgacatcctgcatgccggtcacgtctcctacctg
gccaatgccggcaagctgggggatcgcctgatcgtggcggtcaacaccgacgagtcggtg
cgtcgcctcaaggggccgggtcgtccggtcaatccgaccgagcgccggatggccgtgctg
gctgcgctgggggccgtggactgggtggtgcccttctccgaggataccccgcagcgactg
atcgccgaggtgctgccggacctgctggtcaagggcggcgactacaagccggaagagatt
gccggttacgccgaggtgaccgccaacggcggcgaggtgcgggtcctcaacttcgaggat
ggctgctccaccagcgacatcatcaagaccatccgcgaacgcggctaa

DBGET integrated database retrieval system