KEGG   Aeromonas hydrophila AL06-06: RY45_20990Help
Entry
RY45_20990        CDS       T03748                                 

Definition
(GenBank) D,D-heptose 1,7-bisphosphate phosphatase
  KO
K03273  D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase [EC:3.1.3.82 3.1.3.83]
Organism
ahh  Aeromonas hydrophila AL06-06
Pathway
ahh00540  Lipopolysaccharide biosynthesis
ahh01100  Metabolic pathways
Module
ahh_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:ahh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    RY45_20990
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ahh01005]
    RY45_20990
Enzymes [BR:ahh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.82  D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase
     RY45_20990
    3.1.3.83  D-glycero-alpha-D-manno-heptose 1,7-bisphosphate 7-phosphatase
     RY45_20990
Lipopolysaccharide biosynthesis proteins [BR:ahh01005]
 Unusual sugar
  RY45_20990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_like HAD_2 PNK3P Hydrolase HAD Hydrolase_6 CBS
Motif
Other DBs
NCBI-ProteinID: AJQ56411
Position
complement(4603551..4604093)
Genome map
AA seq 180 aa AA seqDB search
MSKPAIFLDRDGVINEDTGYVSKVDDFHFLPGVIEALQLMKKKGYLLVVVTNQSGIARGY
FSEDDFMNLTEWMDWSLADRDVDLDGIYFCPHHPEHGAPCDCRKPEPGMLLLAKQELNID
MSHSYMVGDKPSDLKAAINAGVGHKIMVRTGKPVTDAGVELADAIYDNLHDFAVAAPTVA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaaaccagccatttttctggatcgtgatggtgtcattaacgaagacaccggttat
gtcagcaaggtagatgacttccactttttgcccggggtcatcgaagccctgcagctgatg
aagaagaaagggtatctactggtcgttgtcaccaatcagtctggtatcgcccgcggttat
ttcagcgaagatgatttcatgaacctgaccgagtggatggattggtcattggccgatcgc
gacgtggacctcgatggtatctacttctgcccccatcatccggagcatggtgctccctgt
gactgccgcaaaccagaaccgggaatgttgctgcttgcgaagcaagagctgaacatcgat
atgagccattcttatatggtgggcgacaaaccttccgatctgaaagcggccatcaatgcc
ggggttggtcacaagatcatggtcagaacgggcaaaccggtaacggatgctggtgtcgag
ctggccgatgccatctatgacaatctgcatgattttgccgtagcagcccccactgtggcc
tga

DBGET integrated database retrieval system