KEGG   Aeromonas hydrophila AL06-06: RY45_21970Help
Entry
RY45_21970        CDS       T03748                                 

Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
ahh  Aeromonas hydrophila AL06-06
Pathway
ahh00540  Lipopolysaccharide biosynthesis
ahh01100  Metabolic pathways
Module
ahh_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:ahh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    RY45_21970
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ahh01005]
    RY45_21970
Enzymes [BR:ahh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     RY45_21970
Lipopolysaccharide biosynthesis proteins [BR:ahh01005]
 Unusual sugar
  RY45_21970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 KR
Motif
Other DBs
NCBI-ProteinID: AJQ56784
Position
complement(4825759..4826715)
Genome map
AA seq 318 aa AA seqDB search
MIVVTGGAGFIGSNLVKQLNAQGRTDVVVIDDLTDGTKFVNLVDLTIADYMDKDEFQARI
VSGDEFEEWDGGIEVIFHEGACSATTEWNGKFIMEVNYEYSKDLFHYCIEREIPFIYASS
AATYGGRNDNFIEDPKFEQPLNVYGYSKQLFDQYVRRWMPEINSQVVGLKYFNVYGPREQ
HKGSMASVAFHLNTQVKKGENPKLFEGCDGFPNGGQMRDFIYVDDVCKVNLWFWMNPQHS
GIFNCGTGRAEPFQNVAEAVIKHHQKGAIEYIPFPDHLKGRYQSFTQADMTKLRGVGYNA
EFKTVAEGVADYMAWLNR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtagtaactggcggtgctggctttatcggcagcaatctggtcaagcagctgaac
gctcaaggacggaccgatgtggtggtcatcgatgacctgaccgacggcaccaagttcgtc
aatctggtcgatctgaccattgccgattacatggataaggatgagttccaggcgcggatt
gtctccggcgacgaatttgaagagtgggatggcggcatcgaggtgatcttccacgagggt
gcctgctccgccaccaccgagtggaacggcaaattcatcatggaggtcaactacgagtac
tccaaggatctgttccactactgcatcgagcgggaaattccgtttatctacgcctcttct
gccgccacctatggcggtcgcaacgacaacttcatcgaagatccgaagttcgagcagcca
ctcaacgtctacggctactccaagcagctgttcgaccagtacgtgcgtcgctggatgccg
gagatcaactctcaggtagtcggtctcaagtacttcaacgtctatggcccgcgcgaacag
cacaagggctccatggcctcggttgccttccacctcaatacccaggtgaagaagggcgag
aatcccaagctgttcgaaggctgcgacggtttccccaacggcggccagatgcgcgatttc
atctatgtggatgacgtctgcaaggtgaatctatggttctggatgaatccgcagcactcc
ggcatcttcaactgcggtaccggtcgggccgaaccgttccagaacgtggccgaagcggtg
atcaagcatcatcagaagggtgccatcgagtacattcccttcccggatcacctcaagggt
cgctatcagagcttcacccaggctgacatgaccaagctgcgtggcgtcggctataacgcc
gagttcaaaaccgtggccgaaggggtcgcggattatatggcgtggctcaaccgctaa

DBGET integrated database retrieval system