KEGG   Aeromonas hydrophila AH10: VU14_10105Help
Entry
VU14_10105        CDS       T03886                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ahi  Aeromonas hydrophila AH10
Pathway
ahi00071  Fatty acid degradation
ahi00072  Synthesis and degradation of ketone bodies
ahi00280  Valine, leucine and isoleucine degradation
ahi00310  Lysine degradation
ahi00362  Benzoate degradation
ahi00380  Tryptophan metabolism
ahi00620  Pyruvate metabolism
ahi00630  Glyoxylate and dicarboxylate metabolism
ahi00640  Propanoate metabolism
ahi00650  Butanoate metabolism
ahi00900  Terpenoid backbone biosynthesis
ahi01100  Metabolic pathways
ahi01110  Biosynthesis of secondary metabolites
ahi01120  Microbial metabolism in diverse environments
ahi01130  Biosynthesis of antibiotics
ahi01200  Carbon metabolism
ahi01212  Fatty acid metabolism
ahi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ahi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VU14_10105
   00630 Glyoxylate and dicarboxylate metabolism
    VU14_10105
   00640 Propanoate metabolism
    VU14_10105
   00650 Butanoate metabolism
    VU14_10105
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VU14_10105
   00072 Synthesis and degradation of ketone bodies
    VU14_10105
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VU14_10105
   00310 Lysine degradation
    VU14_10105
   00380 Tryptophan metabolism
    VU14_10105
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VU14_10105
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VU14_10105
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VU14_10105
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ahi04147]
    VU14_10105
Enzymes [BR:ahi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     VU14_10105
Exosome [BR:ahi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VU14_10105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKA17199
UniProt: A0A1B8Z0Q7
Position
2259557..2260720
Genome map
AA seq 387 aa AA seqDB search
MDIVIVAAKRTPMGAFQGALANLTAPELGACAIAAAMAEVGLRGEQIDEAYLGNVLSAGV
GQAPARQAVLKAGLPDSIPCTTVNKVCGSGMKAVMLAADGLRLGDTKVVIAGGMESMSRA
PYLLDKARSGFRMGHQSVLDHMFLDGLQDAYEGQLMGHYAQLSADRAGLTRADMDAFAIA
SLERALAAQRSGAFAAELAPVMAGDVLLLAEDEQPAKARPEKIPQLKPAFSKTGTITAAN
ASSISDGAAALILMRGETAAQLGLPVLARLVGYQSHAALPAEFTSAPIGAIKGLLAKVGW
RVEEVDLFEVNEAFAMVSLLAMAGCQLPHDKVNVNGGACALGHPLGASGARILVTLIHAL
RERGLKRGVASLCIGGGEATAVALELG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgtgattgttgcggccaaacgtacccccatgggggccttccagggggccttg
gccaacttgacggcacccgaactgggcgcctgtgccattgctgcggccatggcagaggtc
gggctcaggggagagcagatcgatgaagcctatctgggcaacgtgctgagtgccggggtc
ggccaggcacccgcccgtcaggcggtgctgaaggcgggcctgccggacagcatcccctgt
accacggtcaacaaggtgtgcggctccggcatgaaggcggtgatgttggcggccgatggc
ttgcggctcggcgataccaaggtagtgatcgccggcgggatggagagcatgagccgcgcc
ccctatctgctcgacaaggcgcgcagcggttttcggatggggcaccagagcgtgctcgat
cacatgttcctcgacgggctgcaggatgcctacgaagggcagctgatggggcattatgcc
cagctgagcgccgatcgcgccggactgacccgtgccgacatggatgcctttgccatcgca
tcgctggagcgggcgctggcggcccagcgcagcggtgcctttgcggcggagctggcgccg
gtgatggccggagatgtcctgctgctggcggaggatgagcagcctgccaaggccaggccc
gagaagatcccccagctcaagcctgccttcagcaagacgggtaccatcacggcggccaat
gccagctccatctcggacggggcggctgcactgatcctgatgcggggtgaaactgcggcg
cagctgggactgccggtgctggcgcgactggtgggttatcagagccacgcggccctgccc
gccgagtttaccagcgcaccgatcggggccatcaagggcctgttggccaaggtgggttgg
cgggtggaggaggtggatctgttcgaggtcaacgaggcgtttgccatggtcagcctgctg
gcgatggccggttgccagctgccccatgacaaggtcaacgtgaatggcggcgcctgcgcg
ctcggtcatccgctgggggcgagtggtgccaggatcctggtgacgctgatccatgctctg
cgcgaacgcggtctcaaacgtggggtggccagtctgtgtatcgggggcggggaggcgacg
gcggttgcactcgagctgggttaa

DBGET integrated database retrieval system