KEGG   Aeromonas hydrophila AH10: VU14_10275
Entry
VU14_10275        CDS       T03886                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
ahi  Aeromonas hydrophila AH10
Pathway
ahi00230  Purine metabolism
ahi01100  Metabolic pathways
ahi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ahi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    VU14_10275
Enzymes [BR:ahi01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     VU14_10275
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AKA17230
Position
2306881..2309199
AA seq 772 aa
MSIGLPLKRVDAEAKVTGSARYTDDNIMLGMRHAKYVRSHIAHGKVLTIDASEALALHGV
EAVFTHEDVPTTCFRTAGHAWSLDETKRDVKDRRLLTDHVRHFGDGVAIVVARDPLVAEK
AAALVKVTYEPLPVMTDAASALAEGSCPIHPTGNLLRQSQIRAGEPEQAIAAADMQFKGH
YQTPVVQHCHLETVTCYAYMDQPDHIIVVTSTQIPQIVRSRVAKSLGLPWSSVRVIKPYM
GGGFGNKQDVLEEPMAAFLSYQLGGVPVKVTLSREECFFASRTRHGFAIDGTLGINRDGV
LKGYQLDVLSNTGGYASHGHSIASAGGNKISYLYPRSAFGYDAKTFYSNLPTAGAMRGYG
APQVVFALECMLDDACAELDLDPLAVRIANVAREGDVNQVNQKTIYSAGLPECLRRGGEQ
FEWERLKAECLAQDPASRVRRGIGVACFSYGSNTYPVGVEIAGARMLLNQDGTVNLQIGA
TEIGQGSDTVFAQMAAQTLGIPFEQIRVISTQDTDITAYDPGSFASRQSYVAAPAIHQAA
LQLRARILSLAAQLCHQDVGSLTLIDGYVVLAGAPDKVLISVAEVSVNAYYHLTIGGQIT
SEVSHKTTTNPPSFGCTFVDLSVDIDLCKVTINRILNLHDAGKILNPQLAEGQVHGGMGM
GIGWSLFEEMIIDAKTGVVRNPNLLDYKFPTMLDLPELECDFVQTYEPQSVYGHKSLGEP
PIISPGPAIRNAIRMATGVAINELPITPKTLFREFVAAGLIGEGAGEEQRHV
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgtccataggattaccgctcaagcgggtggatgccgaggccaaggtgaccggcagcgcc
cgctacaccgacgacaacatcatgctcggcatgcgccacgccaagtacgtgcgaagccat
atcgcccacggcaaggtgctcaccatcgacgccagcgaggcgctggccctgcacggggtc
gaagccgtgttcacccacgaggatgtgcccaccacctgttttcgcaccgccggccacgcc
tggtccctcgatgagaccaagcgggacgtgaaagaccggcgtctgctcaccgaccatgtg
cgccattttggcgatggcgtcgccatcgtggtggcgcgcgatccgctggtcgccgagaag
gccgccgccctggtcaaggtgacctacgagccgctgccggtgatgacggatgcggccagt
gccctggccgaggggtcctgtcccatccacccgaccggcaacctgctgcgccagagccag
atccgggcgggagagccggaacaggccatcgccgccgccgacatgcagttcaaggggcac
taccagacgccggtggtgcagcactgtcatctggagacggtcacctgctacgcctatatg
gatcagccggaccacatcatcgtcgtcaccagcacccagatcccccagattgtgcgcagc
cgggtggccaaatccctcggcctgccctggtcgagcgtgcgggtgatcaagccctacatg
ggtggcggttttggcaacaagcaggatgtgctggaagagccgatggcggcatttttgagc
taccagctcggcggcgtgccggtcaaggtgaccttgagccgggaggagtgcttctttgcc
tcccgcacccgccacggctttgccatcgacggcactctcggtatcaaccgggatggcgtg
ctcaaggggtatcaactggacgtgctctccaacaccggcggctatgcttcccacggccac
tccatcgccagcgccggtggcaacaaaatcagctacctctatccgcgcagtgcctttggc
tacgacgccaaaaccttctacagcaacctgcccaccgccggtgccatgcgcggttacggc
gcaccgcaggtggtgtttgccctcgaatgcatgctggacgatgcctgcgccgagctggat
ctggatccgctcgccgtgcgcatcgccaacgtggcccgtgagggggacgtcaatcaggtc
aaccagaagaccatctacagcgcagggctccctgagtgcctgcgccggggcggcgagcag
ttcgagtgggagcggctcaaggccgagtgtctggcgcaggatccggcgagtcgggtacgg
cgcggcatcggggtggcgtgctttagctatggctccaacacctatccggtgggggtggag
atcgccggcgcccgcatgctgctcaatcaggatggcaccgtcaatctgcagatcggcgcc
accgagatagggcagggatcggataccgtttttgcccagatggcggcccagacgttaggc
attccgtttgagcagatccgggtcatctcgacccaggataccgacattaccgcctacgac
ccgggctcgtttgcctcgcgccagagctatgtggcggcccctgccatccatcaggcggcg
ctgcagctgcgggcgcgcatcctctcgctggcggcccagctctgccatcaggatgtggga
tcgctgaccctgatcgacggttacgtggtgctggccggtgcgccggacaaggtgctgatc
agcgtcgccgaggtgtcggtcaacgcctactaccacctcaccatcggcggccagatcacc
tcggaagtctcccacaagaccaccaccaacccgcccagctttggctgcaccttcgtcgat
ctcagcgtcgacatcgatctctgcaaggtgaccatcaaccgcatcctcaacctgcacgat
gcgggcaagatcctcaacccgcagctggctgaggggcaggtgcacggcggcatggggatg
gggatcggctggtcgctgttcgaggagatgatcatagacgccaagaccggcgtggtgcgc
aaccccaacctgctcgactacaagttccccaccatgctggatttgcccgagcttgaatgc
gacttcgtgcagacctatgagccccagtcggtctatggccacaaatccctgggggagccg
cccatcatctcgccgggcccggcgatccgtaacgccattcgcatggcgaccggggtcgcg
atcaacgagctgcccatcacccccaagaccctgtttcgggagtttgtcgcggcgggtctg
attggcgagggagcaggggaggagcaacgccatgtttga

DBGET integrated database retrieval system