KEGG   Aeromonas hydrophila AH10: VU14_10285
Entry
VU14_10285        CDS       T03886                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
ahi  Aeromonas hydrophila AH10
Pathway
ahi00230  Purine metabolism
ahi01100  Metabolic pathways
ahi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ahi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    VU14_10285
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AKA17232
Position
2310067..2310552
AA seq 161 aa
MMQPQSCPTVAIQCEINGKPYSYAVSPTMSLLHFLRGQGLISVKEGCSVGECGACTVRVD
GTAIDSCLYLAVWADGKSIRTVEGERQGNELSDVQQAFIDEGAVQCGFCTPGLVMASAAL
LDKTDRRPLTEAEIRRGLSGNLCRCTGYQNVVRAVKKCCKG
NT seq 486 nt   +upstreamnt  +downstreamnt
atgatgcaaccgcaaagctgtcccactgttgcgatccagtgcgagatcaacggcaaaccc
tactcctacgcggtgtcgcccaccatgtcgctgcttcacttcctgcgcgggcaggggctt
atcagcgtgaaagaggggtgcagtgtcggtgagtgcggcgcctgtaccgtgcgggtggat
ggcacggccatcgacagctgcctctatctggcggtgtgggccgatggcaaatccattcgc
accgtggagggagaacggcagggcaacgagctctccgacgtgcagcaggcctttatcgac
gagggggcggtgcagtgcggcttttgcaccccggggctcgtgatggcgagcgccgccctg
ctcgacaagacagatcgccgtcccttgaccgaggcggagatccgccgcggcctgtcgggg
aatctgtgccgttgcaccggttatcagaacgtggtccgggcggtgaagaagtgctgcaag
gggtga

DBGET integrated database retrieval system