KEGG   Aeromonas hydrophila AH10: VU14_12075Help
Entry
VU14_12075        CDS       T03886                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ahi  Aeromonas hydrophila AH10
Pathway
ahi00480  Glutathione metabolism
ahi00590  Arachidonic acid metabolism
ahi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ahi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    VU14_12075
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    VU14_12075
Enzymes [BR:ahi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     VU14_12075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AKA17555
UniProt: A0A1V2F230
Position
2687349..2687825
Genome map
AA seq 158 aa AA seqDB search
MSLPDLILQRLDGTELPLSTLQGQVVLVVNVASRCGFTPQYTGLEALYRELGPRGLVILG
FPCDQFGHQEPGDAEEIARFCSLDYPVSFPIMAKCEVNGEQAHPFYQWLKKEKPGLLGLE
NVKWNFTKFLIDRDGKVVDRFAPTTKPESLRDDILALL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgtcattgcccgaccttatcctgcaacgccttgacggtaccgaactgcccttgtccacc
ctgcaaggccaggtcgtgctggtggtcaacgtcgccagccgctgcggctttaccccccag
tacaccggcctggaggcgctttatcgcgaactgggcccacgcgggctggtgatcctgggc
ttcccctgcgatcaattcggccatcaggagccgggagatgcagaggagatcgcccgcttc
tgctccctcgactatccggtcagcttccccatcatggccaagtgcgaggtcaacggcgaa
caggcccaccccttctatcaatggctcaagaaagagaaaccgggcctgctggggctggag
aacgtcaagtggaacttcaccaagtttctgatcgaccgggacggcaaggtggttgaccgc
tttgcccccaccaccaaacccgagagcctgcgagacgatatcctggccctgctctga

DBGET integrated database retrieval system