KEGG   Aeromonas hydrophila AH10: VU14_16305Help
Entry
VU14_16305        CDS       T03886                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00027  malate dehydrogenase (oxaloacetate-decarboxylating) [EC:1.1.1.38]
Organism
ahi  Aeromonas hydrophila AH10
Pathway
ahi00620  Pyruvate metabolism
ahi01200  Carbon metabolism
ahi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ahi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VU14_16305
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VU14_16305
Enzymes [BR:ahi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.38  malate dehydrogenase (oxaloacetate-decarboxylating)
     VU14_16305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malic_M malic
Motif
Other DBs
NCBI-ProteinID: AKA18341
UniProt: A0A081UTV8
Position
complement(3656541..3658235)
Genome map
AA seq 564 aa AA seqDB search
MFEDNNQKRPLYIPYAGPALLETPLLNKGSAFTSEERSNFNLEGLLPQNIETIEEQAERA
YRQFMAFGNDMDKHIYLRNIQDTNETLFYRLLTNHLTEMLPVIYTPTVGKACEEFSNIYR
RARGLFISYPDKDRIDDMLQNATKQNVKVIVVTDGERILGLGDQGIGGMGIPIGKLSLYT
ACGGISPAYCLPVVLDVGTNNQQLLNDPFYMGWRNPRISGEEYAEFVDAFIQAVKRRWPD
ILLQFEDFAQNNAMPLLNRYKNELCCFNDDIQGTAAVTLGSLIAACKASGAKLSEKRVAF
LGAGSAGCGIAEQIVAQMKAEGLTDAQARSRVFMVDRFGLITDKIPNQLDFQRRLSQPVE
RIADWPVGDNISLLEVMEHGRPDILIGVSGQPGLFTEEVVKTMHKHCARPIIFPLSNPTS
RVEATPADLIRWTDGQALVATGSPFAPVEYKGKRYVIAQCNNSFIFPGIGLGVIAAGATR
VTDAMLMSASRALAECSPLVKGEEGSLLPDLADIHQVSRYIAKMVAKTAMLQGKAVQTPD
EVIDQSIEANFWRPEYRRYRRTSF
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaagataataaccagaaacgtcccctctacattccctacgccggtccggccctg
ctggagaccccgctgctcaacaagggcagcgccttcaccagcgaagagcgcagcaacttc
aacctcgaagggctgctgccccagaatatcgagaccatcgaagagcaggccgagcgggcc
taccgtcagttcatggcgttcggcaacgacatggacaagcacatctacctgcgcaacatc
caggacaccaacgagacgctgttctaccggttgctgaccaaccacctgaccgagatgctg
ccggtcatctacaccccgaccgtcggcaaggcgtgcgaggagttctccaacatctatcgt
cgcgcccgcggtctgttcatctcctatccggacaaggacaggatcgatgacatgctgcaa
aacgccaccaagcagaacgtcaaggtgatcgtggtcaccgacggtgagcggatcctgggt
ctcggcgatcagggcatcggcggcatgggcattcccatcggcaaactgtcgctctacacc
gcctgtggtggcatctcgccggcctactgcctgccggtggtgctggacgtgggtaccaac
aaccagcagctgctgaatgaccccttctacatgggttggcgcaatccgcgcatctcgggt
gaagagtatgccgagttcgtcgacgccttcattcaggcggtcaagcgccgctggcctgac
atcctgctgcagttcgaggacttcgcccagaacaacgccatgccgctgctcaatcgctac
aagaacgagctctgctgcttcaacgatgacattcagggcaccgccgccgtgaccctcggc
agcctcatcgccgcctgcaaggcctccggcgccaagctctccgagaagcgggtcgccttc
ctcggcgctggcagcgccggttgcggcatcgccgagcagatcgtggcgcagatgaaagcc
gaggggctgaccgatgcccaggctcgcagccgggtcttcatggtggaccgcttcggcctc
atcaccgacaagatccccaaccagctcgacttccagcgccgcctctcccagccggtggag
cgcatcgccgattggccggtgggggacaacatctccctgctggaggtgatggagcacggt
cgcccggacatcctgatcggggtctccgggcagccggggctgttcaccgaagaggtggtc
aagaccatgcacaagcactgtgcccgtcccatcatcttcccgctctccaaccccacctcc
cgggtcgaggcaaccccggcagatctcatccgctggaccgacggccaggcgctggtggcc
actggcagcccgtttgcaccggtggagtacaagggcaagcgctacgtcattgcccagtgc
aacaactccttcatcttcccggggataggccttggcgtcatcgccgccggtgccacccgg
gtgaccgatgccatgctgatgtcggccagccgcgcactggcagagtgctcgccgctggtg
aagggggaggagggctccttgctgccggatctggcggacattcaccaggtctcccgctac
atcgccaagatggtggccaagaccgccatgctgcagggcaaggcggtacagaccccggac
gaggtgatcgatcaatccatcgaggccaacttctggcgccccgagtatcgccgttatcgc
cgtacctccttctga

DBGET integrated database retrieval system