KEGG   Aeromonas hydrophila J-1: V469_06240Help
Entry
V469_06240        CDS       T03574                                 

Definition
(GenBank) peptidase M28
  KO
K05994  bacterial leucyl aminopeptidase [EC:3.4.11.10]
Organism
ahj  Aeromonas hydrophila J-1
Brite
KEGG Orthology (KO) [BR:ahj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ahj01002]
    V469_06240
Enzymes [BR:ahj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.10  bacterial leucyl aminopeptidase
     V469_06240
Peptidases [BR:ahj01002]
 Metallo Peptidases
  Family M28: aminopeptidase Y family
   V469_06240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M28 Peptidase_M20 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: AJE35527
Position
complement(1314742..1315923)
Genome map
AA seq 393 aa AA seqDB search
MKPLLTALLLPLLPLAVQAAEPVWITVGADSGVELKQVKAKLAPLFSASGAPVQLAQVEA
SELGTLSHLMHEGHQRCGGYVVHSTLADALQSMAQPISQNLFSAPPLTQGASVNRLLPYL
DQGNIVGTISQLASWRNRYYTTTTGVQSADWVAGQWQTLSATLPWASVSRVKHSGYPQQS
VVLTLKGSRYPDEVVVLGGHLDSTAGSAPNSRTLAPGADDDASGIATLTEVLRVIAEQGR
QPERTLQFIGYAAEEVGLRGSKDIATRYKAANTKVLAALQLDMTNYQGSAQDIVFITDYT
DQGLTGYLAQLLDAYLPQIRYGYDSCGYGCSDHASWHNQGYPAAMPFESRFNDYNPNIHT
AQDTLQNSDPSAAHALKFAQLATSFAIEMGKIN
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccttgttgaccgccctcttgctccccctgctgcccctcgccgtacaggccgcc
gagcccgtctggatcacggtcggtgccgacagcggcgtcgaactcaagcaggtcaaggcc
aaactggcccccctgttcagcgccagcggcgccccggtccagctggcccaggtcgaggcg
agcgagcttggcaccctctcccacctgatgcacgaagggcatcagcgctgcggcggctat
gtggtgcacagcaccctggccgacgccctgcagagcatggcccagcccatcagccagaac
ctgttcagcgccccgccgctgacccagggggccagcgtcaaccggctgctgccctatctg
gatcagggcaacatagtcggcaccatcagccagctcgccagctggcgcaaccgctactac
accaccaccacaggggtgcagtcggcggactgggtggccggccagtggcaaaccctgagc
gcgaccctgccctgggccagcgtcagccgggtcaagcacagcggctatccgcagcaatcc
gtggtgctgaccctcaagggcagccgctacccggacgaagtggtggtactcggcggtcac
ctcgactccaccgcgggctccgcccccaacagccgcaccctggcccccggcgccgatgac
gatgcctccggcatcgctaccctgaccgaggtgctgcgggtcatcgccgagcagggccgc
cagccggagcgcaccctgcagttcatcggctatgcggcggaagaggtggggctgcgcggc
tccaaggacatcgccacccgctacaaggcggccaataccaaggtgctggcggcgctgcag
ctggacatgaccaactatcagggctcggcacaagacatcgtcttcataaccgactacacc
gaccaggggctgaccggctatctggcccagctgctggacgcctatctgccccagatccgc
tacggctatgacagctgcggttacggctgctcggatcacgcctcctggcacaatcagggc
tacccggccgccatgccgttcgagtcgcgcttcaacgactacaaccccaacatccacacc
gcccaggacaccttgcaaaactcggatccctcggctgcccacgccctcaagttcgcccag
ctggccaccagcttcgccatcgagatgggcaagataaactga

DBGET integrated database retrieval system