KEGG   Aeromonas hydrophila J-1: V469_10340Help
Entry
V469_10340        CDS       T03574                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ahj  Aeromonas hydrophila J-1
Pathway
ahj00071  Fatty acid degradation
ahj00072  Synthesis and degradation of ketone bodies
ahj00280  Valine, leucine and isoleucine degradation
ahj00310  Lysine degradation
ahj00362  Benzoate degradation
ahj00380  Tryptophan metabolism
ahj00620  Pyruvate metabolism
ahj00630  Glyoxylate and dicarboxylate metabolism
ahj00640  Propanoate metabolism
ahj00650  Butanoate metabolism
ahj00900  Terpenoid backbone biosynthesis
ahj01100  Metabolic pathways
ahj01110  Biosynthesis of secondary metabolites
ahj01120  Microbial metabolism in diverse environments
ahj01130  Biosynthesis of antibiotics
ahj01200  Carbon metabolism
ahj01212  Fatty acid metabolism
ahj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ahj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    V469_10340
   00630 Glyoxylate and dicarboxylate metabolism
    V469_10340
   00640 Propanoate metabolism
    V469_10340
   00650 Butanoate metabolism
    V469_10340
  09103 Lipid metabolism
   00071 Fatty acid degradation
    V469_10340
   00072 Synthesis and degradation of ketone bodies
    V469_10340
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    V469_10340
   00310 Lysine degradation
    V469_10340
   00380 Tryptophan metabolism
    V469_10340
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    V469_10340
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    V469_10340
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    V469_10340
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ahj04147]
    V469_10340
Enzymes [BR:ahj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     V469_10340
Exosome [BR:ahj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   V469_10340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJE36244
UniProt: A0A1U6XZR2
Position
2264622..2265785
Genome map
AA seq 387 aa AA seqDB search
MDIVIVAAKRTPMGAFQGALANLTAPELGACAIAAAMAEAGLRGEQVDEAYLGNVLSAGV
GQAPARQAVLKAGLPDSIPCTTVSKVCGSGMKAVMLAADGLRLGDTKVVIAGGMESMSRA
PYLLDKARSGFRMGHQSVLDHMFLDGLQDAYEGQLMGHYAQLSADRAGLTRADMDAFAIA
SLERALAAQRSGAFAAELAPVMAGDTLLLAEDEQPAKARPEKIPQLKPAFSKTGTITAAN
ASSISDGAAALILMRSDTAVQLGLPVLARLVGYQSHAALPAEFTSAPVGAIKGLLAKVGW
RVEEVDLFEVNEAFAMVSLLAMAGCQLPHDKVNVNGGACALGHPLGASGARILVTLIHAL
RERGLTRGVASLCIGGGEATAVAIELG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgtgattgttgcggccaaacgtacccccatgggggccttccagggagccctg
gccaacctgacggcacctgaactgggggcctgtgccattgccgcggccatggcagaagcg
gggctcaggggagagcaggtcgatgaagcctatctgggcaacgtgctgagtgccggggtc
ggccaggcacccgcccgccaggcggtgctgaaggcgggtctgccggacagcatcccctgc
accacggtcagcaaggtgtgcggttccggcatgaaggcggtgatgctggcggccgatggc
ttgcggctcggcgataccaaggtggtgatcgccggcgggatggagagcatgagccgcgcc
ccatatcttctggacaaggcgcgcagtggttttcggatggggcaccagagcgtgctcgat
cacatgttcctcgacggactgcaggatgcctacgaaggccagctgatggggcattatgcc
cagctgagcgccgatcgcgccggactgacccgtgccgacatggatgcctttgccatcgca
tcgctggagcgggcgctggcggcccagcgcagcggtgcctttgcggcggagctggcgcct
gtgatggccggagataccctgctgctggccgaggatgagcagcctgccaaggccaggccc
gagaagatcccccagctcaagcctgccttcagcaagacgggcaccatcacggcggccaat
gccagctccatctcggacggggcggcggcgctgatcctgatgcgctccgacactgccgtg
cagctgggactgccggtgctggcgcgactggtgggttatcagagccacgcggccctgccc
gccgagtttaccagcgcaccggtaggggccatcaagggcctgctggccaaggtgggttgg
cgggtggaggaggtggatctgttcgaggtcaacgaggcgtttgccatggtcagcctgctg
gcgatggccggttgccagctgccccatgacaaggtcaacgtgaacggcggcgcctgcgcg
ctgggtcatccgctgggggcgagtggtgccaggatcctggtgaccctgatccatgccctg
cgcgaacgcggtctcacacgcggggtggccagtctgtgtatcgggggcggggaggcgacg
gcggtcgccatcgagctgggttaa

DBGET integrated database retrieval system