KEGG   Aeromonas hydrophila J-1: V469_10545
Entry
V469_10545        CDS       T03574                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
ahj  Aeromonas hydrophila J-1
Pathway
ahj00230  Purine metabolism
ahj01100  Metabolic pathways
ahj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ahj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    V469_10545
Enzymes [BR:ahj01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     V469_10545
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AJE36281
Position
2315642..2317960
AA seq 772 aa
MSIGLPLKRVDAEAKVTGSARYTDDNIMLGMRHAKYVRSSIAHGKVLTIDASDALALHGV
EAVFTHEDVPTTCFRTAGHAWSLDETKRDVKDRRLLTDHVRHFGDGVAIVVARDPLVAEK
AAALVKVTYEPLPVMTDAASALAEGACPIHPTGNLLRQSQIRAGEPEQAIAAADLQFKGH
YQTPVVQHCHLETVTCYAYMDQPDHIIVVTSTQIPQIVRSRVAKSLGLPWSSVRVIKPYM
GGGFGNKQDVLEEPMAAFLSYKLGGVPVKVTLSREECFFASRTRHGFAIDGTLGISRDGT
LKGYQLDVLSNTGGYASHGHSIASAGANKISYLYPRSAFGYDAKTFYSNLPTAGAMRGYG
APQVVFALECMLDDACAELDLDPLAVRIANVAREGDVNQVNQKTIYSAGLPECLRRGGEQ
FEWERLKAECLAQDPASRVRRGIGVACFSYGSNTYPVGVEIAGARMLLNQDGTVNLQIGA
TEIGQGSDTVFAQMAAQTLGIPFEQIRVISTQDTDITAYDPGSFASRQSYVAAPAIHQAA
LQLRARILSLAAQLCHQDVGSLTLIDGYVVLAGAPDKVLISVAEVSVNAYYHLTIGGQIT
SEVSHKTTTNPPSFGCTFVDLSVDIDLCKVTINRIFNLHDAGKILNPQLAEGQVHGGMGM
GIGWSLFEEMIIDAKTGVVRNPNLLDYKFPTMLDLPELECDFVQTYEPQSVYGHKSLGEP
PIISPGPAIRNAIRMATGVAINELPITPKTLFREFVAAGLIGEGSGEEQRHV
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgtccataggattaccgctcaagcgggtggatgccgaggccaaggtgaccggcagcgcc
cgctataccgacgacaacatcatgctcggcatgcgccacgccaagtatgtgcgaagctcc
atcgcccacggcaaggtgcttaccatcgacgccagcgacgcgctggccctgcacggggtc
gaagccgtgttcacccacgaggatgtgcccaccacctgttttcgcaccgccggtcacgcc
tggtccctcgatgagaccaagcgggatgtgaaagaccgccgtctgctcaccgaccatgtg
cgtcacttcggcgatggggtcgccatcgtggtggcccgcgatccgctggtggccgaaaaa
gcggcagcactggtcaaggtgacctacgagccgctgccggtgatgacggatgcggccagc
gcgctggccgagggagcctgtcccatccacccgaccggcaacctgctgcgccagagccag
atccgggcgggagagccggagcaggccatcgccgccgccgacttgcagttcaaggggcac
taccagacgccggtggtgcagcattgccacctggagacggtgacctgctacgcctacatg
gatcagccggaccacatcatcgtcgtcaccagcacccagatcccccagattgtgcgcagc
cgggtggccaaatcccttggcctgccctggtcgagcgtgcgggtgattaagccctacatg
ggcggcggttttggcaacaagcaggatgtgctggaagagccgatggctgcgtttctgagt
tacaagctcggtggcgtgccggtcaaggtgaccctgagccgggaggagtgcttctttgct
tcccgcacccgccacggctttgccatcgacggtaccctcggcatcagccgggatggcacc
ctcaagggctatcagctcgacgtgctctccaacaccggcggctatgcctctcatggccac
tccatcgccagcgccggcgccaacaagataagctacctctatccacgcagcgcctttggc
tatgacgccaaaaccttctacagcaacctgcccaccgccggtgccatgcgcggttacggc
gcgccgcaggtggtgtttgccctcgaatgcatgctggacgatgcctgcgccgagttggat
ctggatccgcttgcggtgcgcatcgccaacgtggcccgcgagggggacgtcaatcaggtc
aaccagaagaccatctacagcgcagggctccctgagtgcctgcgcaggggcggcgagcag
ttcgagtgggagcggctcaaggccgagtgtctggcgcaggatccggcgagccgggtgcgg
cgtggcatcggggtagcctgcttcagctacggctccaacacctatccggtgggggtcgaa
attgccggtgcccgcatgctgctcaaccaggatggcaccgtcaatctgcagatcggcgcc
accgagatagggcaggggtcggataccgtctttgcccagatggcggcccagaccttgggc
attccgtttgagcagatccgggtcatctcgacccaggataccgacatcaccgcctacgat
ccgggctcgttcgcctcgcgccagagctatgtggcggcccccgccatccatcaggcggcg
ctgcagctgcgggcccgcatcctctcgctggcggcccagctctgtcatcaggatgtgggg
tcgctcacgctgatcgacggctacgtggtgctggccggcgcgccggacaaggtgctcatc
agcgtcgccgaggtgtcggtcaacgcctattaccacctcaccatcggcggccagatcacc
tcggaagtctcccacaagaccaccaccaacccaccgagctttggctgcaccttcgtcgat
ctcagcgtcgatatcgatctctgcaaggtgaccatcaaccgtatcttcaacctgcacgat
gcgggcaagatcctcaacccgcagctggcggaggggcaggtgcacggcggcatggggatg
gggatcggctggtccctgttcgaggagatgatcatcgacgccaagaccggcgtggtgcgc
aaccccaacctgctcgactacaagttccccaccatgctggatttgccagagctcgagtgc
gacttcgtgcagacctacgagccccagtcggtctatggccacaaatctttgggggagccg
cccatcatctcgccgggcccggccattcgcaacgccatcaggatggcgaccggggtcgcc
atcaacgagctacccatcacccccaagaccctgttccgggagtttgtcgcggcgggtctg
attggcgagggatcaggggaggagcaacgccatgtttga

DBGET integrated database retrieval system