KEGG   Aeromonas hydrophila J-1: V469_10555
Entry
V469_10555        CDS       T03574                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
ahj  Aeromonas hydrophila J-1
Pathway
ahj00230  Purine metabolism
ahj01100  Metabolic pathways
ahj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ahj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    V469_10555
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AJE36283
Position
2318828..2319313
AA seq 161 aa
MMQPQSCPTVAIQCEINGKPYSYAVSPTMSLLHFLRGQGLISVKEGCSVGECGACTVRVN
GTAIDSCLYLAVWADGKSIRTVEGERQGNELSDVQQAFIDEGAVQCGFCTPGLVMASAAL
LDKTERRPLTDAEIRRGLSGNLCRCTGYQNVVRAVKKCCKG
NT seq 486 nt   +upstreamnt  +downstreamnt
atgatgcaaccgcaaagctgtcccactgttgcgatccagtgcgagatcaacggcaaaccc
tactcctacgcggtgtcgcccaccatgtcgctgctccacttcctgcgcgggcaggggctt
atcagcgtaaaagaggggtgcagtgtcggcgagtgcggcgcctgtaccgtgcgggtgaac
ggcacggccatcgacagctgtctttatctggcggtgtgggccgatggcaaatccattcgc
accgtggagggggagcggcagggcaatgagctatccgacgtgcagcaggcctttatcgac
gagggggcggtgcagtgcggcttttgcacgcctggcctcgtgatggcgagcgcagccctg
ctcgacaagaccgaacgccgtccgctgactgatgcggagatccgccgcgggctgtcgggg
aatctgtgccgctgtaccggttaccagaacgtggtgcgggcggtgaagaagtgctgcaag
gggtga

DBGET integrated database retrieval system