KEGG   Aeromonas hydrophila J-1: V469_13330Help
Entry
V469_13330        CDS       T03574                                 

Definition
(GenBank) FMN reductase
  KO
K10678  nitroreductase [EC:1.-.-.-]
Organism
ahj  Aeromonas hydrophila J-1
Pathway
ahj00633  Nitrotoluene degradation
ahj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ahj00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    V469_13330
Enzymes [BR:ahj01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     V469_13330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: AJE36766
Position
complement(2927381..2928106)
Genome map
AA seq 241 aa AA seqDB search
MNPTLDLILAHRSIRQFTAEPITDIQLDQILSAAQAASSSSFLQANSIIRVTDKALRSRL
AELAGHQAYVAQAAEFLLFCADYHRHCEVVPDAQTGFVEQLLIGAIDGALMAQNALLAAQ
SMGLGGVYIGGIRNNPAAVSEAVGLPHQVIPLFGLCLGHPAQAPEQKPRLPRALVVHENR
YQTELDRELLAGYDQQIEAYYQSRSSNNKLQSWSGQIRGILGKEARPFMQDFLRSRGFNL
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgactctcgaccttattctcgcccatcgctccattcgtcaattcaccgctgag
cccatcaccgacattcagctcgaccagatcctgagcgcggcccaggccgcttccagctcc
agcttcctgcaggccaacagcatcatccgggtgaccgacaaggcactgcgcagccgactg
gccgaactggcgggacaccaggcctatgtggcccaggccgccgagttcctgctcttttgc
gccgactaccatcgccactgcgaagtggtgccggatgcccagaccggctttgtcgagcag
ctgctgatcggtgccatcgacggcgccctgatggcccagaatgccctgctggcagcccaa
tccatgggtcttggcggcgtctatatcggcgggatccgcaacaatccggccgccgtgagc
gaggcggtggggctgccacatcaggtgatcccgttgttcggcctctgcctcggccacccc
gctcaggcgcccgaacagaaaccccgcctgcctcgggctctggtggtgcatgaaaaccgc
tatcagaccgaactggatcgtgagctgcttgccggctacgaccagcagatcgaggcttac
taccagtcccgcagcagcaacaacaagctgcagagctggagcggccagatccggggtatc
ctgggcaaggaggcgcgtcccttcatgcaggatttcctgcgatccagggggttcaacctc
aagtaa

DBGET integrated database retrieval system