KEGG   Aeromonas hydrophila J-1: V469_19170Help
Entry
V469_19170        CDS       T03574                                 

Definition
(GenBank) pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
ahj  Aeromonas hydrophila J-1
Pathway
ahj00250  Alanine, aspartate and glutamate metabolism
ahj00330  Arginine and proline metabolism
ahj01100  Metabolic pathways
ahj01110  Biosynthesis of secondary metabolites
ahj01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ahj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    V469_19170
   00330 Arginine and proline metabolism
    V469_19170
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ahj03000]
    V469_19170
Enzymes [BR:ahj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     V469_19170
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     V469_19170
Transcription factors [BR:ahj03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    V469_19170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: AJE37857
Position
complement(4189644..4192808)
Genome map
AA seq 1054 aa AA seqDB search
MFKATQVLAADYVPSDLAALREAITQNYVVDENAYLAELSAMLPGDGASLERVTQRARTL
VTKVRKESGSGDGIDAFLQEYSLDTQEGIILMCLAEALLRIPDAETADALIKDKLSGANW
SSHFRKSDSTLVNASTWGLMLTGKIIKLDKKLDGNPANLLGRMVNKLGEPVVRSAMYAAM
KIMGKQFVLGRDMKEALKASRKSREKGYTHTYDMLGESALTLADADKYFGDYQRAIEAVG
NERISDGGPAPSISIKLSALHPRYDVANRERVLGEMCERLVGLVRLARDKDVAISIDAEE
MDRLELSLDLFEQLYRSEANRGWGKLGMVVQAYSKRALPVLCWLTGLAREQGDLIPVRLV
KGAYWDSELKYAQQAGLPGYPLFTRKAGTDISYLACARYLLSEPTRGFISPQFATHNANT
VVSILEMAGDRQFEFQRLHGMGEELHNAVLNEHPGLHCRIYAPVGAHKDLLPYLVRRLLE
NGANTSFVHKLVDPNTPVDSLAEHPLRTLKRYSSLANDRIPQPVNLFSDRKNSSGVNMNI
VSIQRPFFAKLKELESKQWLAGPIVDGETLKRNEARVVLSPQDVSQLVGKIHWADEQAVE
QALASAHAAFPRWRETPVSERAASLEKLADLLEANREQFISLCTREAGKLLQDGIDEVRE
AVDFCRYYAVQARGLMGQATLLPGYTGEMNELFLQGRGVFVCISPWNFPLAIFLGQVAAA
LATGNTVIAKPAEQTGLIAHLAVTLAHQAGIPGDVLQLLPGDGATVGAKLTADARIGGVC
FTGSTETAKLINMTLAQRDGAILPLIAETGGQNAMIVDSTALPEQVVRDVVSAAFQSAGQ
RCSALRVLYLQEEIAPRVLEILTGALQELKVGNPAEHNTDVGPVIDAEAKAGLDAHLVHM
IPRARLIAQAPMPAVTLGGHFVQPTALEIGSIRELTREQFGPILHVVRYAARDLDKVISD
INGTGYGLTLGIHSRNESHAEELASRINVGNVYINRNQIGAMVGVQPFGGQGLSGTGPKA
GGPHYLSRFITEKTRTINTTAVGGNASLLAMGDA
NT seq 3165 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaagctacccaagtgcttgccgctgactatgttccctccgatctggccgccctg
cgcgaagccatcacccagaactacgtggtggatgaaaatgcctatctggccgagctgtcg
gccatgctgccgggggacggcgcctcgctggagcgggtgacccagcgtgcccgcaccctg
gtgaccaaggtgcgcaaggagagcggctccggcgacggcatcgacgccttcctgcaggag
tacagcctggatacccaggaggggatcatcctgatgtgtctggcggaggcgctgctgcgc
attcccgatgccgagactgccgatgccctgatcaaggacaagctctccggcgccaactgg
tcgtcccattttcgcaagagcgactccaccctggtgaacgcctccacctgggggctgatg
ctgaccggcaagatcatcaagctggacaagaagctggacggcaacccggccaacctgctg
ggccgcatggtcaacaagctgggggagccggtggtgcgctccgccatgtacgccgccatg
aagatcatgggcaagcagttcgtgctggggcgcgacatgaaggaagccctcaaggcgagc
cgcaagtcccgcgagaagggttatacccacacctacgacatgctgggggagtccgccctg
accctggccgatgccgacaagtatttcggtgactaccagcgcgccatcgaggcggtgggc
aacgagcgcatcagcgacggcggcccggccccttccatctccatcaagctgtcggcgttg
catccgcgctatgacgtggccaaccgcgagcgggtgctcggcgaaatgtgcgagcggctg
gtgggattggtgcgcctcgcccgcgacaaggacgtggccatcagcatcgacgccgaggag
atggaccgcctcgagctctctctcgatctgttcgagcagctctatcgctccgaggcgaac
cgcggctggggcaagctcggcatggtggtgcaggcctactccaagcgcgccctgccggtg
ctctgctggctgaccgggctggcccgcgagcagggcgatctcattccggtgcggctggtg
aagggcgcctactgggacagcgagctgaaatatgcccagcaggccggcctgcccggctac
ccgctgtttacccgcaaggcgggcaccgacatatcctacctcgcctgcgcccgctacctg
ctgagcgagccgacccgcggcttcatctcgccccagtttgccacccacaacgccaacacc
gtggtcagcattctggagatggctggcgatcgccagtttgaattccagcgtctgcacggc
atgggggaggagctgcacaacgccgtactgaacgagcatcccggcctgcactgccgtatc
tatgcgccggtgggtgcccacaaggatctgctgccctacctggtgcgccgcttgctggag
aacggggccaacacctccttcgtccacaagctggtggatcccaacaccccggtcgactcc
ctggccgagcacccgctgcgcaccctcaagcgctactccagcctggccaacgatcgcatt
ccgcagccggtgaatctgttcagcgaccgcaagaactccagcggcgtcaacatgaacatc
gtctccatccagcgccccttcttcgccaagctgaaagagctggagagcaagcagtggctg
gcgggccccatcgtcgatggcgagaccctcaagcgcaacgaagcccgcgtggtgttgagc
ccgcaggatgtgagccagctagtgggcaagatccactgggccgacgagcaggcggtggag
caggcgctggcctcggcccatgccgccttcccgcgctggcgcgagaccccggtgagcgag
cgtgccgcctcccttgagaaactggcggatctgttggaagcgaaccgcgagcagttcatc
tccctctgtacccgcgaggcgggcaagctgctgcaggacggcatcgacgaggtgcgcgag
gcggtggacttctgccgttactacgcggtgcaggcccgcggcctgatggggcaggcgacc
ctgctgccgggttacaccggcgagatgaacgagctgttcctgcagggacgtggcgtgttc
gtctgcatcagcccatggaacttcccgctggcgattttcctgggccaggtcgccgcggcg
ctggccaccggcaacaccgtcatcgccaagccggccgaacagaccggtctcatcgcccac
ctggcggtgaccctggcccatcaggccggcattcccggtgacgtgctgcaactgttgccg
ggtgacggcgccaccgtgggcgccaagctgacggcggatgcccgcatcggcggcgtctgc
ttcaccggctccaccgagaccgccaagctgatcaacatgaccctggcccagcgcgatggc
gccatcctgccgctcatcgccgagaccggcggtcagaacgccatgatcgtcgattccacc
gccctgccggagcaggtggtgcgcgatgtggtgagcgccgccttccagagtgccggccag
cgctgctccgccctgcgggtgctctacctgcaggaagagatcgcgccgcgggtgctggag
attttgaccggtgccctgcaggagctcaaagtgggcaacccggccgagcacaacaccgac
gtgggcccggtcatcgacgccgaggccaaggccgggctggatgcgcacctggtgcacatg
atcccgcgtgcccgcctgatcgcccaggcaccgatgccggccgtgaccctggggggccac
ttcgtgcagccgactgcgctggagatcggctccatccgcgagctgacccgcgagcagttc
ggccccatcctgcacgtggtgcgctacgccgcccgggatctggacaaggtgatcagcgat
atcaacggcactggttacggcctgacgctggggatccacagccgcaacgaatcccatgcc
gaggagctggcgagccgcatcaatgtcggcaacgtctacatcaaccgcaaccagatcggc
gccatggtcggggtgcagccgttcggcgggcaagggctctccggcaccggtccgaaggcg
ggcggcccccactacctgagccgtttcattaccgagaagacccgcaccatcaacaccacg
gcggtgggcggcaacgcctccctgctggcgatgggcgacgcctga

DBGET integrated database retrieval system