KEGG   Aeromonas hydrophila J-1: V469_19860Help
Entry
V469_19860        CDS       T03574                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ahj  Aeromonas hydrophila J-1
Pathway
ahj00480  Glutathione metabolism
ahj00590  Arachidonic acid metabolism
ahj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ahj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    V469_19860
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    V469_19860
Enzymes [BR:ahj01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     V469_19860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx DUF5046 Redoxin AhpC-TSA DUF4044
Motif
Other DBs
NCBI-ProteinID: AJE37985
Position
complement(4336033..4336566)
Genome map
AA seq 177 aa AA seqDB search
MKWIMLLLTLGAGAAVAACPDYFNVEMRELNSTQRHNLCQLTEGKVVLVVNTASYCGYRG
QFRDLETLYQTYKEKGLVVLGFPSNDFWQEAGEEGKTASVCRRDYGVTFPMFNRIAVRGA
DASPLYRGLAAAAGEAPGWNFHKYLVSRDGKLVASYGANQNPADDPLQKEVKRALGL
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggatcatgttgttgctgacactcggggccggggcggccgtcgccgcctgtcct
gactacttcaacgtggagatgcgggagctcaacagcacccagcgccacaacctctgccag
ctgaccgagggcaaggtggtactggtggtcaataccgcttcctactgcggctatcgcggc
cagttccgggatctggagacgctctaccagacctacaaggagaaggggttggtagtgctc
ggcttcccctccaacgacttctggcaggaggcgggggaggagggcaagaccgcctcggtc
tgccgacgcgattacggggtcaccttccccatgttcaaccggatcgccgtgcgcggggcc
gatgccagcccgctttaccgggggttggccgcggcggcgggcgaggcgccgggctggaac
tttcacaaatacctggtcagccgtgacggcaagctggtcgcgagttatggggcaaaccag
aatccggcggacgatcccctgcaaaaagaggtcaaacgggcgctcggcctttag

DBGET integrated database retrieval system