KEGG   Acinetobacter haemolyticus: AHTJS_01915Help
Entry
AHTJS_01915       CDS       T04618                                 

Definition
(GenBank) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
ahl  Acinetobacter haemolyticus
Pathway
ahl00740  Riboflavin metabolism
ahl00790  Folate biosynthesis
ahl01100  Metabolic pathways
ahl01110  Biosynthesis of secondary metabolites
ahl02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ahl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    AHTJS_01915
   00790 Folate biosynthesis
    AHTJS_01915
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AHTJS_01915
Enzymes [BR:ahl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     AHTJS_01915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: APR69266
UniProt: A0A1L6KJJ8
Position
complement(395623..396396)
Genome map
AA seq 257 aa AA seqDB search
MVTGSVIILNYVTVNQPLLCGLYEKEKLNIKNQKFQFTQSSHIKLYFHCFNHNSELSVPI
EFIATSKLPTAFGDFNISVFQDPETGEEHVALSKGLETAPNQPVLVRIHSECLTGDAFAS
LKCDCGPQLQATQRLINEAGQGVILYLRQEGRGIGLTNKIRAYALQDQGHDTVDANLLLN
LPADARRYDMCSIMLDHLQVKEVKLLTNNPLKLKALTDLGINVVERVPLTVGRNPFNEHY
LKTKRERMDHLYKKDDF
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
ttggtgactggctcggtgattatcctgaattatgtcactgttaatcaaccattattgtgt
ggtttgtatgaaaaagaaaaactcaatataaaaaatcagaaattccaattcactcaatct
tcacacattaagctatactttcactgttttaatcataatagtgagctctctgtgccaatt
gaatttattgctacatcaaagctaccaactgcttttggtgacttcaatatttccgtgttc
caagacccagaaacaggtgaagagcatgtggcgctttctaaaggcttagaaactgctccc
aatcaacccgtactggtacgtattcactctgagtgtttaactggtgacgcttttgcttca
ttaaagtgtgattgtggaccacagctgcaagccacgcaacgcctaattaatgaggctgga
caaggtgtaattttatatttacgtcaagagggtcgcgggattggtttgaccaataaaatt
cgtgcctatgccttgcaagatcaaggtcatgataccgttgatgcaaacttattgttaaat
ctacctgctgatgcgcgtcgttatgatatgtgcagcatcatgctcgatcatctgcaagtg
aaagaagtaaaattgctgacgaacaatccactcaaactaaaagcactcactgatcttgga
attaatgtggtcgagcgcgttccgctcactgtaggtcgcaatccgttcaatgaacattat
ttaaaaaccaaacgtgagcgcatggatcatctttataaaaaagatgacttctaa

DBGET integrated database retrieval system