KEGG   Acinetobacter haemolyticus: AHTJS_02525Help
Entry
AHTJS_02525       CDS       T04618                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
ahl  Acinetobacter haemolyticus
Pathway
ahl00430  Taurine and hypotaurine metabolism
ahl00620  Pyruvate metabolism
ahl00640  Propanoate metabolism
ahl00680  Methane metabolism
ahl01100  Metabolic pathways
ahl01120  Microbial metabolism in diverse environments
ahl01200  Carbon metabolism
Module
ahl_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:ahl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AHTJS_02525
   00640 Propanoate metabolism
    AHTJS_02525
  09102 Energy metabolism
   00680 Methane metabolism
    AHTJS_02525
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    AHTJS_02525
Enzymes [BR:ahl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     AHTJS_02525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: APR69372
UniProt: A0A1L6KJX7
Position
complement(507154..508347)
Genome map
AA seq 397 aa AA seqDB search
MVRCSNVAISVLVINCGSSSIKYALISERREDRIYGLAENLGAADARIKGITIGGEPLEL
SIPYADHAKALETLLARLANYNPQAIGHRVVHGGTMTHAERLTQDTIDRIRHAVPLAPLH
NPANLIGIEATLALFPHLPQVAVFDTAFHQTMPERAYRYALPQFLYSDYQVRRYGFHGTS
HAYVSERASELAGQKNQGGWLSAHLGNGSSTCAIWNGESIDTSMGMTPLEGVVMGTRSGD
VDPSLPLFLSNNLGWDIQKIDNMLNKESGLLGLSDLSNDMRTLVEASENGHEGATLAIEV
FCYRLAKSLSALSCGLPRLDGLIFTGGIGENAANIREKTVAYLPHFGLQFSVEKNNSLAR
GTEGRIDHGTGPQIWVIPTDEEGRIAKETRQVLGQLN
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
ttggttaggtgttcaaacgtggctatatctgtattagtaattaattgtggctcttcatct
attaaatatgccctgatctcagaacgtcgtgaagatcgtatttacggtttggcagaaaat
ttaggcgcggctgatgcacggattaaaggcatcacaatcggtggtgaaccacttgaacta
tccatcccttacgcagatcacgccaaagcacttgaaacgctattagctcgtctagcaaat
tataatcctcaagcgatcggacatcgagtggtacatggtgggaccatgacacatgctgaa
cgtttaacgcaggacaccattgatcgtattcgtcatgcggttcctttagcaccgctacac
aatccagccaatttaattggtattgaagccaccttagcgctatttccacatttacctcaa
gtcgctgtctttgatactgcttttcatcaaactatgcctgaacgtgcttatcgttatgca
ctaccacagtttttatactcagattatcaagttcgccgttacggcttccatggtacgagt
catgcctatgtttcagagcgagcaagtgagttagctggccaaaaaaatcaaggtggatgg
ctcagtgcacatcttggtaatggcagctcaacctgtgcaatctggaatggtgaaagtatt
gatacctctatgggaatgacaccgctagaaggtgtcgttatgggcacccgaagtggggat
gttgatccaagcctccctttgttcttatccaacaatctaggatgggatattcagaaaatc
gacaatatgttgaataaagaaagcggtttactgggtttatctgatctttctaatgatatg
cgaaccctagttgaagcctcagaaaatgggcatgaaggtgcaactctcgcaatcgaagtc
ttctgctatcgtctcgctaaatctttatcagctttaagttgtgggctccctcgtttagat
ggtttaatttttacaggtggtattggtgagaacgctgccaatattcgtgagaaaaccgta
gcctatctaccacactttggtttgcaatttagtgtagaaaaaaataatagcttagcacgt
ggtaccgaaggtcggattgatcatggtacaggtccacaaatctgggtcatcccaaccgat
gaagaaggaaggattgccaaagaaacacgccaagtgcttggacaacttaattaa

DBGET integrated database retrieval system