KEGG   Acinetobacter haemolyticus: AHTJS_04380Help
Entry
AHTJS_04380       CDS       T04618                                 

Definition
(GenBank) anion permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ahl  Acinetobacter haemolyticus
Brite
KEGG Orthology (KO) [BR:ahl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AHTJS_04380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: APR69703
UniProt: A0A1L6KKY9
Position
904278..905909
Genome map
AA seq 543 aa AA seqDB search
MNSNLPPASDSPVATESQAQSTNVHVPTPKFFMPVFLTVIVATLIYIGFQVSADLSHVPP
LSLYSVILLSTALFIALAFEFVNGFHDTANAVATVIYTNALPAPVAVMWAGFCNFLGVMV
ASGAVAYGIIALLPVEMIMNVGSGAGFAMVFALLIAAILWNLGTWFLGIPASSSHTLIGS
ILGVGIMNHLLNASTGATSGIDMDQVLKVGKALLFSPMIGFAFAAVLFLLVKKIFKRQME
LFQPPVGNKPPPPLIRGILIFTCTGVSFAHGSNDGQKGMGLIMLILIGLVPLAYSLNKSL
DQKHLQSFEQLSAQTALVLNVDQQEFSDEKARDILTKYIQTKEQTPEVLPALASMTGHLG
EKVAAYGDLKDIPEAGVAELRNDMYLSTTTFKRLDKEDALPVMTTEQQKVVKDYRNNMDS
FLQYIPNWVKVAVALALGLGTMVGWKRIVITVGERIGKNHMTYGQGMSAELVAMSTIAAA
DGFGMPVSTTHVLNSAVAGTMVANKSGLNFATIRTILSAWVFTLPATIALSGGLYWVFLQ
FVS
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaaatctaccccctgcttcggattcaccagttgcgacagaatcgcaagcccaa
tcgacgaatgtacatgtaccaacacctaaattttttatgccggtgttcttaacagtcatt
gttgctacactgatttatattggttttcaggtgagtgctgatttatcacatgtgccacca
ttaagtttatattcagttattttattatctacggcactatttattgccttggcattcgaa
tttgtaaacggttttcatgatactgcaaatgctgttgcgacggtgatttataccaatgcg
cttcctgcaccagtagcggtcatgtgggcaggcttctgtaacttcttaggggttatggtg
gcaagtggtgcagttgcttacggtattattgcattattacctgttgaaatgattatgaat
gtcggcagcggggctggttttgccatggttttcgcgctgttgattgcagcgattttgtgg
aacctcggtacttggtttttgggtatcccagcatcgagttcacacaccttgattggttca
attttaggtgtgggtattatgaatcatttgttaaatgcatcaactggcgcaaccagtggc
attgacatggatcaagtgctaaaggtcggtaaggcgttattattttctccaatgattggt
tttgcttttgcagccgttttattcttattggtgaaaaaaatctttaaacgccaaatggag
ttgttccaaccacctgttggaaataagccaccaccaccactcattcgcggtatcctgatt
ttcacttgtacaggtgtgagttttgctcacggttcaaatgatggtcaaaagggtatgggt
ctaatcatgttgatcttgatcggcttggttccattggcttattcgctgaacaaaagttta
gaccaaaagcatttacaatcttttgagcaattatcagctcaaactgctttggtattgaat
gttgatcaacaagaattttcggatgaaaaagcgcgagatatcctgacaaaatacattcaa
accaaagaacaaacacctgaagttttacctgcattggcgagtatgactgggcatttaggt
gaaaaagttgcagcttatggtgatcttaaagatattccagaagctggagttgctgaatta
cgtaatgatatgtacttaagtactacaacgtttaagcgcttagataaagaagatgcacta
cctgtgatgaccacagaacagcaaaaagtagtaaaagactatcgtaacaatatggattca
ttcctacagtacattccgaactgggtaaaagttgctgttgcattagcacttggcttagga
acaatggtgggttggaaacgtatcgttattacagtgggtgagcgtattggtaaaaatcac
atgacttatggtcaagggatgtctgctgaattggttgcgatgagtacgattgctgccgca
gatggttttggtatgccagtatcgacaacacatgtattaaacagtgcggttgcaggtacc
atggtcgcaaataaatcaggcctaaactttgcaacgattagaaccattctttcagcatgg
gtatttactttgcctgcaacgattgcattatcaggtggtctgtactgggtattcttacag
tttgtatcttga

DBGET integrated database retrieval system