KEGG   Acinetobacter haemolyticus: AHTJS_07250Help
Entry
AHTJS_07250       CDS       T04618                                 

Definition
(GenBank) D-serine ammonia-lyase
  KO
K01753  D-serine dehydratase [EC:4.3.1.18]
Organism
ahl  Acinetobacter haemolyticus
Pathway
ahl00260  Glycine, serine and threonine metabolism
ahl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ahl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AHTJS_07250
Enzymes [BR:ahl01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.18  D-serine ammonia-lyase
     AHTJS_07250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP NmrA
Motif
Other DBs
NCBI-ProteinID: APR70195
UniProt: A0A1L6KM94
Position
complement(1471475..1472806)
Genome map
AA seq 443 aa AA seqDB search
MNSNQIETLVAQHPIVDDLIQLKETIWLNPQTTSLAQGLPSVGLTQQDIDDARDRLTRFA
PYLMSVFPETKISKGIIESELVSIPKMQQTLEAHFKQDITGKLWLKKDSHLPISGSIKAR
GGIYEVLYQAEKLAIQAGLLTVEDDYSKLDSPEFREFFSQYSIAVGSTGNLGLSIGIMSA
KLGFDVTVHMSADARQWKKDKLRSNGVTVIEYAQDYGVAVEEGRKAALKNPNCFFIDDEN
SKTLFLGYAVAGERLKAQLESQNITVDQDHPLFVYLPCGVGGGPGGVAFGLKMALGDHVH
CIFAEPTHSPCMLLGVATGLHDQISVQDLGIDNITAADGLAVGRASGFVGRAMERLLDAF
YTLDDQSMYKLLGLLNQSEDLKLEPSALAGMLGPILISQHQEYAAMHQLTERQMNNANHI
VWATGGGMVPVEEMEIYLQKSKI
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaaaccaaattgaaacccttgttgcacaacatccgattgtcgatgatctgatt
caacttaaagaaacaatttggttgaatccccaaaccacttctttagcacaaggtttgccc
tctgtaggactgactcaacaagatattgatgatgcacgtgatcgtttaactcgcttcgct
ccttatctgatgtctgtatttcctgagactaagataagcaaaggaattattgagtctgaa
ctggtttctattccaaagatgcagcaaacacttgaagctcatttcaaacaagatatcact
ggaaaattatggctaaaaaaagacagccatttgccaatctcaggatcgatcaaagcacgt
ggcggtatttacgaggtgctctatcaggctgaaaaacttgccattcaagcaggcttatta
acagttgaagatgattattcaaaattagatagtccagaatttagagaattttttagtcaa
tacagtattgccgttggctctacgggtaatttaggactttcgattggtatcatgagtgct
aaacttggctttgatgtcactgtgcatatgtcagcagatgcacgccaatggaaaaaagat
aaattacgatcaaacggtgttaccgtaattgaatacgcacaagattatggtgttgcagtt
gaagaaggtcgaaaagccgcattaaaaaatccaaattgtttttttattgatgatgaaaat
tcaaaaactttatttttaggatatgccgttgcaggtgaacgcttaaaagcacaattagaa
tctcaaaatattacggttgatcaagaccatcccttatttgtttatttaccatgtggtgtt
ggtggtggacctggcggtgtcgcatttggactaaaaatggctttgggtgatcacgtacat
tgtatctttgctgaaccgactcattcaccatgcatgttgctgggtgttgcaacagggtta
catgatcaaatttcagtacaagacctaggcattgataacattaccgcagcagatggctta
gctgtaggacgcgcatctggatttgtgggtcgagcgatggaaagactactcgatgctttc
tatacactagatgatcaaagcatgtataaattattaggtctactcaatcaatcagaagat
ttaaaactggaaccatcagccttagctggaatgttaggtccaatcttaatcagtcagcac
caagaatatgctgctatgcatcaactgactgaacgacaaatgaataatgccaatcatatt
gtttgggcgactggtggtggtatggttcctgtggaagaaatggaaatttatctgcaaaaa
tccaaaatataa

DBGET integrated database retrieval system