KEGG   Acinetobacter haemolyticus: AHTJS_07930Help
Entry
AHTJS_07930       CDS       T04618                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ahl  Acinetobacter haemolyticus
Pathway
ahl00071  Fatty acid degradation
ahl00072  Synthesis and degradation of ketone bodies
ahl00280  Valine, leucine and isoleucine degradation
ahl00310  Lysine degradation
ahl00362  Benzoate degradation
ahl00380  Tryptophan metabolism
ahl00620  Pyruvate metabolism
ahl00630  Glyoxylate and dicarboxylate metabolism
ahl00640  Propanoate metabolism
ahl00650  Butanoate metabolism
ahl00900  Terpenoid backbone biosynthesis
ahl01100  Metabolic pathways
ahl01110  Biosynthesis of secondary metabolites
ahl01120  Microbial metabolism in diverse environments
ahl01130  Biosynthesis of antibiotics
ahl01200  Carbon metabolism
ahl01212  Fatty acid metabolism
ahl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ahl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AHTJS_07930
   00630 Glyoxylate and dicarboxylate metabolism
    AHTJS_07930
   00640 Propanoate metabolism
    AHTJS_07930
   00650 Butanoate metabolism
    AHTJS_07930
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AHTJS_07930
   00072 Synthesis and degradation of ketone bodies
    AHTJS_07930
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AHTJS_07930
   00310 Lysine degradation
    AHTJS_07930
   00380 Tryptophan metabolism
    AHTJS_07930
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AHTJS_07930
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AHTJS_07930
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AHTJS_07930
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ahl04147]
    AHTJS_07930
Enzymes [BR:ahl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AHTJS_07930
Exosome [BR:ahl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AHTJS_07930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF5417
Motif
Other DBs
NCBI-ProteinID: APR70313
UniProt: A0A1L6KMN5
Position
1611741..1612913
Genome map
AA seq 390 aa AA seqDB search
MSSIVIVSGSRTAMGGFQGSLSSLTAPELGAAVIRESIQRAGIAPEQVNEVIFGCVLSAG
IGQGPARQAMRKAGIPDHVGAVTINKLCGSAMKAVLMASDALKAGSANIVVAGGMESMTN
APYILPKARGGYRMGHGEIKDHMFLDGLEDAETGRLMGSFAQDMANTKGFTREQMDNFAI
SSLKKAQTAITEGYFKDEIVPVEVKTRKGVEVIDQDEQPLKANLDKIPTLRPAFSKDGTI
TAANSSSISDGAAALVLSTEDYVQANGLNVLAKIVATSSHSQHPSEFTIAPISAIQKVLD
RAGWSVEDVDAWEINEAFAMVAMAPIHELGIDEAKVNIHGGACALGHPIGATGSRIILSL
IYALKRLGKKKGVAALCIGGGEATAVAIEI
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagttctattgttattgtgtcaggtagtcgtaccgcgatgggcggttttcaaggtagt
ctttctagtttaaccgccccagaattaggtgctgctgtaatccgtgaatctatccaacgt
gcgggtattgctccagagcaagtcaatgaagtgatttttggctgtgtgttaagtgcaggc
attggtcaaggccctgctcgtcaagcaatgcgtaaagcgggtattccagatcatgttggc
gctgtgaccatcaataaactttgtggttctgcgatgaaagcagttctgatggcatcagat
gcattgaaagctggtagtgcaaatattgtggttgcaggtggtatggaatctatgaccaat
gcaccatatatcttacctaaagcacgtggtggctaccgtatgggacatggtgaaatcaaa
gaccatatgttcttggatggtttagaagatgctgaaacgggtcgtttaatgggttcattt
gctcaggatatggcaaataccaaaggcttcacccgtgagcaaatggataactttgcgatt
tcttcactcaaaaaagctcaaacagcaattacagaaggatatttcaaagatgaaatcgtc
cctgttgaagttaaaacacgtaaaggtgttgaagtgattgatcaagatgagcaaccactc
aaagcaaatctagataaaatcccaacgctacgccctgcttttagcaaagacggtacgatt
acggcagccaattcaagttcgatttcggatggtgccgccgctttggtgctttctacagaa
gactatgttcaagcaaatggtttaaatgtcttggctaagattgtagctacttcgagtcat
tcgcaacatccaagtgagtttacgattgctccaattagtgcgattcaaaaagtacttgat
cgtgctggctggtcggttgaagatgtcgatgcatgggaaatcaatgaagctttcgcgatg
gtggctatggcaccgattcatgagttaggtattgatgaagctaaagtcaatattcacggt
ggtgcatgtgcgttaggtcatccgattggtgcgacaggttcacgtattattctttcattg
atctatgcattaaaacgtttaggcaaaaagaaaggtgttgcggcattgtgtatcggtggt
ggtgaagcaacagctgtggccatcgaaatttaa

DBGET integrated database retrieval system