KEGG   Acinetobacter haemolyticus: AHTJS_08560Help
Entry
AHTJS_08560       CDS       T04618                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ahl  Acinetobacter haemolyticus
Pathway
ahl00620  Pyruvate metabolism
ahl00630  Glyoxylate and dicarboxylate metabolism
ahl01100  Metabolic pathways
ahl01110  Biosynthesis of secondary metabolites
ahl01120  Microbial metabolism in diverse environments
ahl01200  Carbon metabolism
Module
ahl_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ahl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AHTJS_08560
   00630 Glyoxylate and dicarboxylate metabolism
    AHTJS_08560
Enzymes [BR:ahl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AHTJS_08560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: APR70429
UniProt: A0A1L6KN12
Position
complement(1747387..1749549)
Genome map
AA seq 720 aa AA seqDB search
MTVRIQQGKLAIAKELYDFIENEALPGSGLDSETYWKNFEQVVVDLSLKNKALLAKREEL
QAKIDEWHRNNKFELNAYKAFLTEIGYLVPEVEDFKVTTENVDEEIALLAGPQLVVPVRN
ARYCLNAANARWGSLYDALYGTDVISEENGAEKGKGYNPVRGDKVIAFAKDFLNQTFPLA
QGSHADATKYAVDHNRLVVSLKDGSTTSLEHEAQFVGFNGEAANPTEIVLLNNGLHVIID
IDANSPVGKTDAAGVKDLTLEAAITTIQDLEDSVAAVDAEEKVEGYRNWLGLMKGDLQES
IEKNGKTITRALNKDRTVQNLIGGTTTLHGRSLMLLRNVGHLMTNPAILVDGEEVFEGIM
DALVTPLLTIADIRGQNENHNSRKGSMYIVKPKMHGPEEVAFAVELFERAEQALGLPAKT
LKIGIMDEERRTSVNLKNCIAAAKDRTIFINTGFMDRTGDEIHTSMEAAPVVRKEAVKTQ
KWIAAYENRNVAIGLACGLQGKAQIGKGMWPKPDSMKDMLATKTAHPNAGATCAWVPSPT
GAVLHALHYHQINVKARQDELAAEDMLTLDDLLTPPFAPETNWTAEELNNELENNCQGIL
GYVVRWVDLGVGCSKVPDINNVGLMEDRATLRISSQHVANWLRHGIVTREQVEEVLKRMA
VIVDQQNANDPLYTPMAPNFDGIAFQAASDLIFKGAEQPSGYTEPLLHAARLKLKGYTGD
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgactgtacgtattcaacaaggcaagctagcgattgctaaagaactttacgatttcatc
gaaaatgaagctttaccaggttctggtttagatagtgaaacttactggaaaaacttcgag
caagtcgttgttgatcttagtctaaagaacaaagcgttattggctaagcgtgaagagctt
caagctaaaattgatgagtggcatcgcaataataaatttgaactcaatgcatataaagca
ttcttaactgaaattggttatttagtgccagaagtagaagatttcaaagttacaactgaa
aatgttgacgaagaaattgctttattagcagggcctcagttagtggtacctgtacgtaat
gcacgttactgcttgaatgctgcaaacgctcgttggggttcattgtacgacgcgctttat
ggtacggatgtaatttctgaagaaaatggtgcggaaaaaggcaaaggctataacccagtt
cgtggcgacaaagtcattgcttttgcaaaagatttcttaaaccaaaccttcccgttggcg
caaggttcgcatgcagatgcaacaaaatatgcagttgaccataatcgtttagttgtaagt
ttaaaagatggctcaactacgagcttagaacatgaagcacaatttgttggttttaatggt
gaagctgccaacccaacagaaattgttttattaaataatggcttgcacgttattattgat
atcgatgcaaatagccctgtaggtaaaactgatgcagctggcgtgaaagatttaacgctt
gaggctgcgatcaccactattcaagatttagaagattctgttgcagcagttgatgcagaa
gagaaagtcgaaggttatcgtaactggttaggcttgatgaaaggtgacttacaagagtca
atcgagaaaaatggtaaaaccattactcgtgctttgaataaagaccgcacagttcaaaac
ttaattggtggtacgactactttacatggtcgttcattaatgcttcttcgtaatgtgggt
cacttgatgacaaacccagcgatccttgtagatggtgaggaagtatttgaagggatcatg
gatgctttagttacgccattacttacaattgctgatatccgtggccaaaacgagaatcac
aactctcgtaaaggttctatgtacatcgtaaaaccaaagatgcatggtcctgaagaagtt
gctttcgcagttgaattgtttgagcgtgctgaacaagcgcttggcttaccagctaaaaca
ctcaaaatcggtatcatggacgaagaacgtcgtacctcagtgaatttgaagaactgtatc
gctgcggctaaagatcgtacaatcttcattaacacaggtttcatggaccgtacgggtgat
gaaatccatacttctatggaagctgcaccagttgtacgtaaagaagccgttaagacccag
aaatggattgctgcttatgaaaaccgtaacgttgcgattggtttagcatgtggtttacaa
ggtaaagctcagattggtaaaggcatgtggccaaaaccagatagcatgaaagatatgttg
gcgactaagactgcacatccaaatgctggtgcaacttgtgcatgggttccatctccaacg
ggtgcagtacttcatgcgttgcattaccatcaaatcaatgtaaaagcgcgccaagatgaa
ttggctgcggaagatatgttgacacttgatgacttattaactccaccatttgcacctgaa
acaaattggactgcagaagagttaaataatgagcttgagaataactgccaaggtatttta
ggttatgttgttcgttgggtagatttgggtgtgggttgttcgaaagttccagatatcaac
aacgttggtttgatggaagatcgcgcaacattacgtatttcttctcaacatgttgctaac
tggttacgtcacggtatcgtaacgcgcgaacaagttgaagaagtgcttaagcgcatggct
gtgattgttgatcaacaaaatgccaatgatccattgtacacgccaatggcaccgaacttt
gatgggattgcattccaagcagcatcagatttaatctttaaaggtgctgagcagccatca
ggttacacagagccattattacatgctgcacgtttaaaacttaaaggttatacaggtgac
taa

DBGET integrated database retrieval system