KEGG   Acinetobacter haemolyticus: AHTJS_11560Help
Entry
AHTJS_11560       CDS       T04618                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
ahl  Acinetobacter haemolyticus
Pathway
ahl00790  Folate biosynthesis
ahl01100  Metabolic pathways
ahl02020  Two-component system
Module
ahl_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ahl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AHTJS_11560
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AHTJS_11560
Enzymes [BR:ahl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     AHTJS_11560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N Metallophos
Motif
Other DBs
NCBI-ProteinID: APR70936
UniProt: A0A1L6KPD5
Position
complement(2353357..2355135)
Genome map
AA seq 592 aa AA seqDB search
MTAKISRRELIQKSLFGFGALSLSASLTGCNNSSDKENHSLKVSFEHGVASGDPLQDRVI
LWTRLTPNDASARLQVTWQIALDQQFKQIIKTDKVITTASDDFTVKVDATGLKADQSYFY
RFIFGDKISPVGQTKTLAVNTSKVSFAVCSCSNYPAGYFYVYREIAKQNVDVVIHLGDYI
YEYGAGGYAYENAAELGRTLADDNNQEIIKLDDYRKRYALYRQDPDLQAVHQHHPFIVVW
DDHELANDAWREGAENHTEETPNAKNEGKFLERQLAALQAYFEWMPIRPIDDQQVKIYRQ
FDFGHLVQLSMLDTRIIARDEQLDYANYITASGLDAAKFQADLTDRNRTLMGYDQRDWLL
GKLQQSTATWNVLGQQILMSKMQIPAELLFSLAEITSGQPSADTLTKMQAQIKELVTLKM
RLKQGDPTLTLQEKARVLTVAPYNLDAWDGYFAEREMLYGTLAQLKKKIVVLAGDTHNAW
SSNLYSQDGAFVGVELATSSVSSPGMEKYLNIPTDQLQQFEFAFTTLIDELSYCNLNQRG
YLMVEFNEEKVHSEWIFVDSIKKSEYQVDTARHYQLDLDLDLLSIQTNQQVA
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaaaaatttcacgacgggaactgattcaaaaaagtttatttggttttggggct
ttatctttatctgccagtttaacaggatgtaataacagttcagataaagaaaaccattcg
ctgaaagtcagttttgagcatggcgttgcaagtggtgatccattgcaggaccgtgtcatt
ttatggactcgattaacgccaaatgatgcgagtgcacgtttacaagtgacttggcagatt
gcgttagatcaacaatttaaacaaatcatcaaaaccgataaagtcatcaccacagcatcg
gatgactttacggtaaaagttgatgcaacgggtttgaaagcggaccaaagttatttttat
cgctttatatttggagacaagatttctcctgttgggcaaaccaagactttagctgtaaat
acctcgaaagtaagttttgcagtgtgttcttgctctaactatccagcaggctatttttac
gtttatcgtgagatagcaaagcaaaacgtcgatgtggttattcatcttggtgattatatt
tatgaatatggtgcaggtggctatgcttatgagaatgctgctgagttaggacgaactttg
gcagatgataataatcaggaaattatcaaattagatgattatcgcaaacgttatgcttta
tatcgtcaagatccagacctacaagcagtccatcaacatcatccattcatcgtggtttgg
gatgatcatgagttagccaacgatgcgtggcgagaaggggctgagaatcatacagaagaa
acaccaaacgcaaagaatgaaggtaagtttttagaaagacaattagcagctttacaagcc
tattttgaatggatgccaattcgtccaattgatgatcaacaggttaaaatttatcgacag
tttgattttggtcatttagtgcaacttagcatgttggatacccggatcattgcgcgtgat
gaacagttggattatgcaaattacattacagcttcaggattggatgccgcaaaatttcaa
gccgatttgactgatcgcaatcgtactttaatgggatatgatcaacgagactggttgctc
ggaaaactccagcaatccactgcaacatggaatgtattaggccaacagattttaatgagt
aaaatgcagattcctgctgagttgttattttctttggctgagattacttctggtcagcca
agtgccgatacattaaccaaaatgcaagcacagattaaagaactggtcactttaaagatg
cgtttaaaacaaggtgatccaactttaacgttgcaagaaaaagcacgtgtcctaacggtt
gcaccttataacttggatgcatgggatggttattttgctgagcgtgaaatgctgtatggt
actttggcacaattaaaaaagaaaattgttgtcttagcaggggatacgcacaatgcatgg
tcgtctaacttatatagtcaagatggcgcttttgttggtgttgagcttgcaaccagttcg
gtatcttcaccgggtatggaaaagtatctcaatattccaaccgatcaactacaacaattt
gaatttgcatttacgaccttaatcgatgagttgagctattgtaatttaaaccagcgcggt
tatttgatggttgagtttaatgaagaaaaagttcactcagaatggattttcgttgattca
attaaaaaatcagaatatcaagttgatacagctagacactatcagttggatctagatttg
gatttattgtcgattcaaacgaatcagcaagtcgcataa

DBGET integrated database retrieval system