KEGG   Acinetobacter haemolyticus: AHTJS_12680Help
Entry
AHTJS_12680       CDS       T04618                                 

Definition
(GenBank) malate dehydrogenase (acceptor)
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
ahl  Acinetobacter haemolyticus
Pathway
ahl00020  Citrate cycle (TCA cycle)
ahl00620  Pyruvate metabolism
ahl01100  Metabolic pathways
ahl01110  Biosynthesis of secondary metabolites
ahl01120  Microbial metabolism in diverse environments
ahl01200  Carbon metabolism
Module
ahl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ahl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ahl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AHTJS_12680
   00620 Pyruvate metabolism
    AHTJS_12680
Enzymes [BR:ahl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     AHTJS_12680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase DUF4083
Motif
Other DBs
NCBI-ProteinID: APR71133
UniProt: A0A1L6KPY7
Position
2590940..2592580
Genome map
AA seq 546 aa AA seqDB search
MKKFWKYLLALLLVLIVIAVAFLFRPITSKAIKTKSDEPVVDVVLIGGGIMSATLGAYLN
ELQPDWNVRMYERLDAVAQESSNGFNNAGTGHSGFMEMNYTEEKDGKMDVSKAVNVASQF
EIAKQFWAHQVKQGVLGTPNSFINPVPHIAFVWGDNVQFMEKRYAAMIQEPLFAGMKITE
DPAEVQQWAPLVMDGRDPQQKIAATRMDVGSDVNYGAITTQLINHLEKNPNFKLRTSTEV
TGISKNDDNTWSVAFKDLKSGEVSHVKTRFVFIGAGGAAIKLLQMTGLPEAKQYAGFPVG
GEFLVTDNPAITEKHTAKVYGRADLGAPPMSVPHIDTRYIDGKKYVLFGPFATYSNKFLK
YGSQLDLLASTNKNNILPMTAIGLQNADLVQYLISQVLMSDEDRFNELRKYYPEADPKDW
HLRQGGQRVQIIKKEPGKPAKLQFGTEIFASEDKTVTALLGASPGASTSPYIMLNLLEKA
FPEKTKGEWDGKLHEIVRSYGQDLATDPVLLDQIRQYTSSTLGLNYTTPAQLVPAKQQSN
AVAVAQ
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattttggaaatacttattagcactactgcttgtgctaattgttatcgcagtt
gcctttctttttagaccgattacgtcaaaggcaattaaaactaaaagtgacgaacctgtt
gtcgatgtcgtattgatcggtggcggtattatgagtgccacattgggtgcttatctaaat
gagttacaacctgactggaatgttcgcatgtatgaacgtcttgatgcggttgcacaagaa
agttcaaacggtttcaacaatgcgggtactggtcactcaggctttatggaaatgaactat
accgaagaaaaagacggtaaaatggacgtttctaaagccgtgaatgtggcaagccaattc
gaaattgcaaaacaattctgggcgcatcaagtgaaacaaggtgtattgggtacaccaaat
agctttatcaatccagtaccacatattgccttcgtttggggtgataatgtgcaattcatg
gaaaagcgttatgcagcgatgatccaagagccgttgtttgcgggcatgaaaatcactgaa
gatccagcagaagtacagcaatgggcacctttggtgatggatggtcgtgatccacaacaa
aaaatcgcagcaacacgtatggatgtaggttcagatgtgaactatggtgcgattacaaca
caattgatcaaccacctcgaaaaaaatccaaacttcaagctgagaacctctactgaagtc
acaggtatcagtaaaaatgatgacaacacatggtctgtcgcatttaaagacctgaaatct
ggtgaagttagccatgtcaaaacccgctttgtatttattggtgcaggtggtgcagcgatt
aaattattacaaatgactggcttacctgaagcaaaacaatatgctggcttccctgtgggc
ggtgagttccttgtgacagataatcctgcaattactgaaaagcacactgctaaagtctat
ggccgtgcggatctcggcgcaccgccaatgtcagtgccacatattgatacccgttatatt
gatggtaaaaaatatgtattgtttggaccttttgcgacctattcgaacaagttcctgaaa
tatggttctcaactcgacttattagcatcgaccaacaaaaacaacatcttgccaatgact
gcaattggcttacaaaatgcagaccttgttcaatacttgattagccaagtattgatgtct
gatgaagatcgtttcaatgagttgcgaaaatactacccagaagcggatccaaaagactgg
catttacgccaaggcggtcaacgtgttcagatcattaaaaaggaacctggtaaaccagcg
aagttgcagtttggtacagaaatctttgcatctgaagacaaaaccgtaactgctttactt
ggtgcttcgcctggtgcttcaacatcaccttacatcatgctgaatttgcttgaaaaagca
ttcccagaaaaaaccaaaggtgaatgggatgggaagttgcatgagatcgttcgttcttat
ggtcaagaccttgcaacagaccctgtgttacttgatcaaattcgccaatatacaagctca
acactcggcttaaattatacaacgccagctcaacttgttcctgcaaagcaacaaagtaac
gctgtcgctgtggcgcaataa

DBGET integrated database retrieval system