KEGG   Actinoalloteichus hymeniacidonis: TL08_09900Help
Entry
TL08_09900        CDS       T04472                                 

Definition
(GenBank) enolase superfamily enzyme related to L-alanine-DL-glutamate epimerase
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
ahm  Actinoalloteichus hymeniacidonis
Pathway
ahm00051  Fructose and mannose metabolism
ahm01100  Metabolic pathways
ahm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ahm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    TL08_09900
Enzymes [BR:ahm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     TL08_09900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C
Motif
Other DBs
NCBI-ProteinID: AOS62795
UniProt: A0A1D8BVH0
Position
complement(2126469..2127767)
Genome map
AA seq 432 aa AA seqDB search
MSRIVALEVSDVRFPTSRELDGSDAMNPDPDYSAAYLVLRTDEGPDGHGFVFTIGRGNDV
QCAAIELLAPHVVGRDVEKLCADLGGLSRELVSDSQLRWLGPEKGVMHMAVGAVVNAAWD
LAAKRAGMPVWRLLASLTPEQIVELVDWRYLTDALTPDEALEILRAAEPGRSERLQRLER
EGYPGYTTSPGWLGYDDAKLARLATEAVAEGFDLIKLKVGAALDDDVRRLGVARAAVGPD
VRIAIDANQRFDVDTAIPWLRRLREFNPWWIEEPTSPDDVLGHAAIRNAVAPMRVATGEH
VQNRVMFKQLLQAGAIDILQIDATRVGGVNENVAILLLAAKFGVPVCPHAGGVGLCELVQ
HLAMFDYVAVSGALDGRAIEYVDHLHEHFSTPVRIRDGRYQVPIDPGSGAEMLADSRQRF
AYPAGEVWRGGS
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
gtgagccggatcgtcgccctggaggtgtccgacgtccgattcccgacctcccgggaactc
gacggctcggacgccatgaatcccgatcccgactactccgccgcctatctggtgctgcgg
accgacgagggtcccgacggccatggtttcgtgttcaccatcggtcggggcaacgacgtc
cagtgcgcggcgatcgagctgctcgccccgcacgtcgtcggccgcgatgtcgagaagttg
tgcgccgacctgggcgggctgtcccgggagctggtctcggactcgcagcttcgctggctc
ggtcccgagaagggcgtcatgcatatggcggtgggggccgtggtcaacgcagcgtgggac
ctggccgccaagcgcgcggggatgccggtgtggcgactgctggcgagcctgactccggag
cagatcgtcgagttggtggactggcgctatctgaccgacgcgctcacccccgacgaggcg
ctggagatcctgcgggccgccgaacccggccgatccgagcggctacagcgactcgaacgc
gagggctatcccggctacaccacctcgccggggtggctcggttacgacgacgccaagttg
gcgaggttggcgaccgaggcggtcgccgagggtttcgacctgatcaagttgaaggtcggc
gccgccctcgacgacgacgtccgcaggctcggggtggccagggccgcggtgggtcccgac
gtgcggatcgccatcgacgccaaccagcgcttcgacgtcgatacggccatcccctggctg
cgcagactgcgcgagttcaacccgtggtggatcgaggagccgacctcccccgacgacgtc
ctcggccatgccgcgatccgcaacgcggtggcgccgatgcgggtcgccaccggtgaacac
gtccagaaccgggtgatgttcaagcagctcctgcaggccggggcgatcgacatcctgcag
atcgacgccacccgggtcggcggggtgaacgagaacgtggcgatcctgttgctggcggcc
aagttcggggttccggtgtgcccgcatgccggtggagtgggcctctgcgaactggtccaa
cacctggcgatgttcgactacgtggccgtgtcgggagccctcgacggccgggccatcgag
tacgtggaccacctgcatgagcatttcagcaccccggtgcggatccgcgatggccggtac
caggtgccgatcgatcccggatccggtgcggagatgctcgccgactcccgacaacggttc
gcctaccccgcaggcgaggtgtggcgcggcgggtcctga

DBGET integrated database retrieval system