KEGG   Actinoalloteichus hymeniacidonis: TL08_13745Help
Entry
TL08_13745        CDS       T04472                                 

Definition
(GenBank) theronine dehydrogenase-like Zn-dependent dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ahm  Actinoalloteichus hymeniacidonis
Pathway
ahm00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ahm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    TL08_13745
Enzymes [BR:ahm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     TL08_13745
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     TL08_13745
    1.1.1.-  
     TL08_13745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AOS63563
UniProt: A0A1D8BXN4
Position
3008421..3009485
Genome map
AA seq 354 aa AA seqDB search
MSARTSSESARYAVVTAPGAVEIRETAERLEPAADGVVVSITYCGVCGTDTHAYASGGLV
PPSVFGHEWTGAIRAVGAEVTDFAVGDRVVACVGPACGHCAQCRLGNPDHCDTAFAEANG
VTDDAPQWGGFATELAVSARRVMRVLDGLSQEQAALVEPTAVTFHAVKRARQPFGAIVVV
QGAGPIGLLTAQHARHAGAGMVLVVEPSADRRATARALGFAEVHSPGSDFVARVGQVSGG
LGADIVYECSGVAGLLQSSGELVRRGGRLALLGFPMVSSEVSYADWQMRELTVVGSLAYN
HEDFLGAMRAIADGSVRTQELHTGTVGLDDLERILAELESGQSRHAKVLVDPRR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccaggaccagttcggagtccgcgcgttacgccgtcgtcaccgcaccgggtgcc
gtggagatccgggagaccgccgagcggctcgaacctgccgccgacggcgtcgtcgtctcc
atcacctactgcggggtctgcggcaccgacacccacgcctacgcctcgggtggactcgtg
ccgccctcggtgttcggccacgagtggacgggcgccatccgcgcggtgggtgccgaggtc
acggatttcgccgtgggcgaccgggtggtggcctgcgtcggcccggcctgcggccactgc
gcacaatgcagactcggcaatcccgaccactgtgacacggccttcgccgaggccaacggc
gtcaccgacgacgcaccgcaatggggtggattcgccaccgaactggcggtctccgcgcgg
cgggtgatgcgcgtcctcgatgggctcagtcaggagcaggccgccctggtcgaaccgacc
gccgtgacctttcacgccgtcaaacgcgccaggcaacccttcggtgcgatcgtggtcgtg
cagggggccggaccgatcggactgctcaccgcgcagcacgcccgccatgcgggtgccggg
atggtgctggtggtggagccgtccgccgatcggcgggcgacggctcgggccttgggcttc
gccgaggtacacagcccggggtccgacttcgtcgcacgagtcggccaggtctccggcggt
ctcggcgccgacatcgtgtacgagtgcagcggggtggcagggctactgcagtcctccggc
gaactcgtgcgccggggcggccggttggccctgttgggattcccgatggtgtcttccgag
gtgagctacgccgattggcagatgcgcgagctgacggtggtgggctcgctggcctacaac
cacgaggacttcctcggtgcgatgcgggccatcgccgacggctcggtgcgcacccaggaa
ctgcacaccggaacggtcggcctggatgacctggaacggatcctggcggagttggaatcc
gggcagagcaggcacgcgaaggtcctggtcgatccccggcggtga

DBGET integrated database retrieval system