KEGG   Actinoalloteichus hymeniacidonis: TL08_17640
Entry
TL08_17640        CDS       T04472                                 

Definition
(GenBank) xylose isomerase-like enzyme
  KO
K19974  2-epi-5-epi-valiolone 7-phosphate 2-epimerase [EC:5.1.3.35]
Organism
ahm  Actinoalloteichus hymeniacidonis
Pathway
ahm00525  Acarbose and validamycin biosynthesis
ahm01100  Metabolic pathways
ahm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ahm00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    TL08_17640
Enzymes [BR:ahm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.35  2-epi-5-epi-valiolone 7-phosphate 2-epimerase
     TL08_17640
SSDB
Motif
Pfam: AP_endonuc_2
Other DBs
NCBI-ProteinID: AOS64328
UniProt: A0A1D8BZV6
Position
4176826..4177821
AA seq 331 aa
MTAQRPAPPVGNRIAAAGGVVAGVVHPTSAAEGAFGSRAPSADCLVGMVDWRIRESGPAA
VRRSARLGVDGIQLDLGGPGTGPRLDAPGRLDAVREIAESTGVRLLAVCANRLNDIGLTA
RAGSRDAARVQRVLDRLLDAAHFLGAPLVIVPGFRRSAIGGPEHFARTAAVLREAARAAE
ARNLLLGSMNRLDARWSTLLAKAVGSAAFRLMLNPANVTASGTCPVDFVGETAGLLADQV
ALKEVPPDVRAGPEPGSVTDRLDDTLDALRAQRVPVRALVSETDHRDGDPIRLAHDLDRL
RRRARLFTAAPSPRTTPGGGAVHPSSSQADG
NT seq 996 nt   +upstreamnt  +downstreamnt
atgactgcgcagcgtccagccccgccggtcggcaaccgcatcgccgccgcaggcggggtc
gtggcaggcgtcgtccacccgacctcggccgccgagggcgccttcggatcccgggctccc
tcggcggactgcctggtcgggatggtggattggcggatccgagaatccggtccggccgcg
gtacgtcgctcggcccgcctcggagtcgacggcatccaactggatctcggcggccccgga
accgggcctcggctggacgctcccggacggctggacgcggtgcgcgagatcgccgagtcc
accggcgtccggttgctggccgtgtgcgcgaaccggctcaacgacatcgggctcaccgcg
cgggcgggcagtcgcgatgcagcccgggtgcagcgggtcctggaccgattgctcgacgcg
gcgcacttcctcggtgcgccgctggtgatcgtccccggattccggcgcagcgccatcggc
ggtcccgagcatttcgcccgtaccgccgccgtgctgcgtgaagcggcgcgggccgccgag
gcccgaaatctgctgttgggcagcatgaaccggctcgacgcgcggtggtcgaccctgctc
gccaaggcggtcggctcagctgccttccgcctgatgctcaatccggcgaacgtgaccgcc
tcgggcacgtgcccggtcgatttcgttggtgagaccgctgggctgctggccgatcaggtc
gcattgaaagaagtcccacccgacgttcgcgcgggtcccgagccgggatcggtgacggat
cgactggacgacaccctcgacgcactgcgcgcgcaacgggtccccgtacgggcgctcgtc
tcggagaccgaccatcgcgacggtgatccgatccggctggcccacgacctcgaccggctg
cggcggcgcgctcggttgttcaccgcagctccatcgcctcgaaccactcccggcggcggt
gccgtgcatccatcgtcgtcgcaggccgacggctga

DBGET integrated database retrieval system