KEGG   Atlantibacter hermannii: NCTC12129_02161Help
Entry
NCTC12129_02161   CDS       T05790                                 

Gene name
phoQ_1
Definition
(GenBank) sensor protein PhoQ
  KO
K07637  two-component system, OmpR family, sensor histidine kinase PhoQ [EC:2.7.13.3]
Organism
ahn  Atlantibacter hermannii
Pathway
ahn01503  Cationic antimicrobial peptide (CAMP) resistance
ahn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ahn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NCTC12129_02161 (phoQ_1)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    NCTC12129_02161 (phoQ_1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ahn01001]
    NCTC12129_02161 (phoQ_1)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ahn02022]
    NCTC12129_02161 (phoQ_1)
   01504 Antimicrobial resistance genes [BR:ahn01504]
    NCTC12129_02161 (phoQ_1)
Enzymes [BR:ahn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     NCTC12129_02161 (phoQ_1)
Protein kinases [BR:ahn01001]
 Histidine kinases
  OmpR family
   NCTC12129_02161 (phoQ_1)
Two-component system [BR:ahn02022]
 OmpR family
  PhoQ-PhoP (magnesium transport)
   NCTC12129_02161 (phoQ_1)
Antimicrobial resistance genes [BR:ahn01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    NCTC12129_02161 (phoQ_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c
Motif
Other DBs
NCBI-ProteinID: VDZ73054
UniProt: A0A447LMV4
Position
1:complement(1997704..1998000)
Genome map
AA seq 98 aa AA seqDB search
MFEITARQTDDALHLFVDDDGPGIPPGKRAVIFDRGQRIDTLRPGQGVGLSVAREIVEQY
GGQILPGESLLGGTRMEVVFARQGVSGTESSVSGPKTP
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgagatcacggcccggcagacggacgacgccctgcacctgtttgtcgatgacgac
ggccccggcattccgcccggtaaacgcgcggtgattttcgatcgtggacagcgtattgat
acgctacgtccgggccagggcgttgggttgtccgtcgcacgggaaatcgttgagcaatac
ggcgggcaaatccttcccggcgaaagcctgctcggcgggacgcgtatggaagtggtgttt
gcccgacaaggagtgagcggtacggaaagcagcgtcagcgggcccaaaacgccctga

DBGET integrated database retrieval system