KEGG   Atlantibacter hermannii: NCTC12129_03991Help
Entry
NCTC12129_03991   CDS       T05790                                 

Gene name
mtfA_3
Definition
(GenBank) putative RNA 2'-O-ribose methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
ahn  Atlantibacter hermannii
Brite
KEGG Orthology (KO) [BR:ahn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ahn03009]
    NCTC12129_03991 (mtfA_3)
Enzymes [BR:ahn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     NCTC12129_03991 (mtfA_3)
Ribosome biogenesis [BR:ahn03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    NCTC12129_03991 (mtfA_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX Spt5-NGN
Motif
Other DBs
NCBI-ProteinID: VDZ74812
UniProt: A0A447LSY3
Position
1:complement(3605302..3605802)
Genome map
AA seq 166 aa AA seqDB search
MNKVILYCRQGFEKECAAEITDKAALLNVYGFARVKEQSGYVIFECYQPEEADKLARELP
FSSLIFARQMFVGGELLQNLPPEDRITPIVGMLQGVVEKGGDLRVEVADTNESKELMKFC
RKFTVPLRAALREAGVLAKFETAEAPGCTRLLYRARLLLHRLFLLP
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaataaggtaattttgtattgccgccagggttttgaaaaagagtgtgcggcggagatt
accgataaagcggctctcctgaacgtttacggttttgcgcgcgtaaaagagcaatccggc
tatgtcatttttgagtgctatcagccggaagaggccgataagctggcgcgcgaactcccg
ttcagctcactgatttttgctcgccagatgtttgtcggcggcgagctgttacaaaatctg
ccgccggaagatcgcattacgcccatcgtggggatgttgcagggtgtggtggaaaaaggc
ggggatttgcgtgtcgaagtggctgacaccaatgaaagcaaagagctaatgaagttctgc
cgcaaatttaccgtaccgctgcgcgctgcgctacgcgaagcgggggtgttggcgaagttc
gaaaccgccgaagcgcccggttgtacacgtcttctttatcgcgcccggctgctgctacac
cggttattcctactcccataa

DBGET integrated database retrieval system