KEGG   Atlantibacter hermannii: NCTC12129_04050
Entry
NCTC12129_04050   CDS       T05790                                 

Gene name
xdhC
Definition
(GenBank) xanthine dehydrogenase iron-sulfur-binding subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
ahn  Atlantibacter hermannii
Pathway
ahn00230  Purine metabolism
ahn01100  Metabolic pathways
ahn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ahn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NCTC12129_04050 (xdhC)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: VDZ74864
UniProt: A0A447LSZ2
Position
1:3656251..3656733
AA seq 160 aa
MNNESWITVNCAINGAPFRFTTSPAMPLAELLRSQGLLSIKQGCCVGECGACTVLVDGVA
IDSCLYLAAWVEGKTIRTVEGESTGGQLSEVQQAYTRSGAVQCGFCTPGLIMATTALLAK
PHTKPFTVLEIRQGLAGNLCRCTGYQMIVETVQACDRPTE
NT seq 483 nt   +upstreamnt  +downstreamnt
atgaataatgaaagctggataaccgttaactgcgccatcaacggcgcgccgttccggttt
accacctcgcctgcgatgccgctggccgaattattacgttcacagggtttgctgagcatc
aaacaggggtgttgcgtcggggagtgcggcgcctgtaccgtgctggtcgacggggtggcg
attgacagctgcttatacctggcggcgtgggtcgaggggaaaacgattcgcactgttgaa
ggagagtccaccggcgggcagttatccgaggtacagcaggcatatacccgttccggggcg
gtccagtgcgggttctgcacgcccggtctgattatggcgaccaccgccctgctggcgaaa
ccgcatacgaagccgtttaccgtgctggaaatccgccaggggctcgcggggaatttgtgc
cggtgcaccggttatcagatgattgtcgagacggtgcaggcctgcgaccgcccgacagaa
taa

DBGET integrated database retrieval system