KEGG   Acidianus hospitalis: Ahos_0275Help
Entry
Ahos_0275         CDS       T01493                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K18128  D-glyceraldehyde dehydrogenase (NADP+) [EC:1.2.1.89]
Organism
aho  Acidianus hospitalis
Pathway
aho00030  Pentose phosphate pathway
aho01100  Metabolic pathways
aho01120  Microbial metabolism in diverse environments
aho01200  Carbon metabolism
Module
aho_M00309  Non-phosphorylative Entner-Doudoroff pathway, gluconate/galactonate => glycerate
Brite
KEGG Orthology (KO) [BR:aho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Ahos_0275
Enzymes [BR:aho01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.89  D-glyceraldehyde dehydrogenase (NADP+)
     Ahos_0275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA DUF5338
Motif
Other DBs
NCBI-ProteinID: AEE93166
UniProt: F4B501
Position
267179..268666
Genome map
AA seq 495 aa AA seqDB search
MEKIQELFINGEWVKPSSEEYLNKYNPSTGELYGKFAAASKEDVDRAIDAAYDAQKKWEK
LTSVERSKYLYRLIDLIRQDRESLENLLMDEVGKPRKEAVQEVDGVLDQLQYYAEFARKI
TGDVVEGTKPERVIFQYKVPYGVVLAITPWNFPAAMIARKIGPALITGNTVVLKPSSDTP
FVAGWIVEKVRQAGFPPGTVNLITGKGSVIGDYMTSHKKISVITLTGESRTGVQVMKSAS
SIMAKLILELGGKAPFIVWKDADLELAAKVLMWAKYWNAGQSCIAAERLYVHEDVYDKFL
NLFIEKTKTLKIGEPRTSDMGPLINDQQLKKVSGFVEEAVNQGAKILYGGGKPQLPERYS
KGFFYMPTILTDVKQDMRIFREEIFGPVIGAMKVGDDFDEVIELANDSDYGLASYLFTKD
VSLAMKAAREIKFGELYINMPGPEATQGYHTGFRMSGQAGENSRYGVEEYVKVKNVYIDY
SKDPTAGEVIPPYTD
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaattcaagagttattcattaacggagaatgggttaagccttcttctgaagaa
tacctaaataaatataatccttctacaggagaactttacggaaaatttgccgcagcatca
aaagaagacgtagacagagctatagatgcagcatatgacgcacagaagaaatgggaaaaa
ttaacttcggttgagaggagtaaatatctctataggttaattgatctaataagacaggac
agagagagcttagaaaacctattaatggacgaagtaggaaagcctagaaaagaggcagta
caagaagttgatggagtcttagatcagttacagtactatgcagagtttgccagaaaaatt
actggcgacgttgttgagggaacaaagccggagagagttatattccagtataaggttccc
tacggcgtagtccttgccataactccatggaacttcccagctgcaatgatagctagaaaa
attggtcctgcattaataactggtaatacggtagttctaaaacccagctcagatactccg
tttgtagcaggttggatagttgagaaagtaagacaagcaggattcccccctggaactgtt
aacctaataaccggaaaaggaagcgttataggagattacatgacttctcacaagaagatc
tcagtaataaccttgacaggggaatcaaggaccggagtccaagtaatgaaatctgcctcc
tcaattatggctaaattaatcctagagttaggaggaaaagctccatttatcgtatggaag
gatgctgatttagaattagctgcaaaagtacttatgtgggcaaagtactggaacgccggc
caatcatgtattgctgcagagaggctttacgttcatgaagacgtttacgataaattcctc
aatttattcatagagaagaccaagactttaaagataggtgaacctagaaccagtgatatg
gggccgctaataaatgatcaacaattaaagaaagtttctggcttcgttgaagaggcagta
aatcaaggagcaaagatattatacggcggaggtaaaccacagttaccggagaggtattct
aaaggtttcttctacatgcctacaatattaactgacgtaaaacaagatatgaggatattt
agagaagaaatatttggcccagtaattggtgcaatgaaagtcggagacgactttgacgaa
gttatagaattagcaaacgattcagactacggcttagcttcatacttgtttacaaaggac
gttagcctagctatgaaagctgctagggaaataaagtttggagagctttacattaacatg
ccagggccggaagcaactcaaggttaccatacaggatttagaatgtctggccaagctgga
gagaactcaagatatggagttgaagagtacgttaaagtgaagaacgtatacatagactat
agtaaagatccaacggcaggagaagtaattccaccttatacagattaa

DBGET integrated database retrieval system