KEGG   Acidianus hospitalis: Ahos_0791Help
Entry
Ahos_0791         CDS       T01493                                 

Definition
(GenBank) D-fructose 1,6-bisphosphatase
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
aho  Acidianus hospitalis
Pathway
aho00010  Glycolysis / Gluconeogenesis
aho00030  Pentose phosphate pathway
aho00051  Fructose and mannose metabolism
aho00680  Methane metabolism
aho01100  Metabolic pathways
aho01110  Biosynthesis of secondary metabolites
aho01120  Microbial metabolism in diverse environments
aho01130  Biosynthesis of antibiotics
aho01200  Carbon metabolism
aho01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aho00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ahos_0791
   00030 Pentose phosphate pathway
    Ahos_0791
   00051 Fructose and mannose metabolism
    Ahos_0791
  Energy metabolism
   00680 Methane metabolism
    Ahos_0791
Enzymes [BR:aho01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Ahos_0791
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Ahos_0791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: AEE93677
UniProt: F4B800
Position
740557..741717
Genome map
AA seq 386 aa AA seqDB search
MSLMKTTISVIKADIGSLAGHHVVHPDTMAAANKVLAEAKKNGVIIDYYITNVGDDMELI
MTHNRGELDTKVHETAWDAFKEATKVAKDLGLYAAGQDLLSDTFSGNLKGMGPGIAEMEI
EERPAEPIAIFMADKTEPGAFNYPQYKMFADPFNTAGLVIDPTMHEGYKFEILDVYAGES
VTLNAPEEIYDILALIGTPSQYVIRRVYRKADNMIASVTSIERLNLLAGKYVGKDDPVMI
VRVQHGFPALGEVLEAFSFPYLVPGWMRGSHYGPLMPVSQRDARATRFDGPPRLIGLGFN
VKNGRLVGPSDLFDDPAFDETRRLAEQIADYMRRHGPFMPHRLEPTEMEYTTLPLIQQKL
KARFKKEAGVAEAKKSIYEKQVEGGD
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttatgaagaccacaataagcgtaattaaagcagatataggaagtttagctggg
catcatgtagtccatccagatactatggcagcagcaaacaaagtgttagctgaggctaaa
aaaaatggtgtaataatagattattatataacgaatgtcggagacgatatggaacttatt
atgactcataatagaggtgaattagatactaaagttcatgaaactgcttgggatgcgttt
aaagaagctactaaggtagctaaagatcttggattatatgctgcagggcaagatttacta
tctgatacattttctggaaacttaaagggaatgggtccaggaatagcagagatggaaata
gaagaaaggcctgcagaacctatagcaatttttatggcagataagacagaacctggagca
ttcaattatccccaatataaaatgtttgctgatccatttaatactgcaggtttagttata
gatccaactatgcatgaaggttataaatttgaaattttagacgtttatgcaggagaatct
gtaacgcttaatgctccagaggaaatttatgatatattagcattaattggaactccttct
caatacgtcatcagaagagtctataggaaagcagataatatgatagcgtcagttacatca
atagaaagattaaatctcttagcaggaaaatacgtaggaaaagacgaccctgttatgatc
gttagagttcaacatggttttcctgcattaggtgaagtgctagaagctttctctttccca
tatttagttccagggtggatgagaggaagccattatggtcctttaatgccagtttcgcag
agagatgctagagcaactagattcgacggccctccaagattaataggattaggattcaat
gttaaaaatggaagactagtaggtcctagcgacttatttgatgatccagcttttgatgaa
acgagaagattagcagaacaaatagcagactatatgaggagacacggtccatttatgccg
catagactagaaccaaccgaaatggaatatactactttacctctaattcaacagaaatta
aaggctagatttaagaaagaagctggagtagcagaagcaaagaaaagcatatatgaaaaa
caagttgaaggaggagactaa

DBGET integrated database retrieval system