KEGG   Acidianus hospitalis: Ahos_1308Help
Entry
Ahos_1308         CDS       T01493                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type II
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
aho  Acidianus hospitalis
Pathway
aho00010  Glycolysis / Gluconeogenesis
aho01100  Metabolic pathways
aho01110  Biosynthesis of secondary metabolites
aho01120  Microbial metabolism in diverse environments
aho01130  Biosynthesis of antibiotics
aho01200  Carbon metabolism
aho01230  Biosynthesis of amino acids
Module
aho_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:aho00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ahos_1308
Enzymes [BR:aho01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Ahos_1308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N GFO_IDH_MocA NAD_binding_3 2-Hacid_dh_C NAD_binding_2 Semialdhyde_dh HIN Chordopox_A35R Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AEE94191
UniProt: F4B483
Position
complement(1180360..1181382)
Genome map
AA seq 340 aa AA seqDB search
MIKVALNGYGTIGKRVANAIMLQPDMKLIGIAKTSPNYEAFIAQKMGINIFVPQESIKSF
DEAGIKVAGNIEDMIKEADIVVDATPNGVGAQYKELYQKFGKNAIFQGGEKANVADVSFS
SLCNYNEAIGKKYIRVVSCNTTALLRTICTLNKLSKVEKVRATIVRRAADPKEVKKGPIN
ALVPDPASVPSHHAKDVNSVLKDLDIITMAVIAPTTYMHMHLLNVTLKSQVSKEDVINQF
LNTNRFLLVRGKSKVNSTAEIIEVARDLGRIRNDIPEVVIFEDSIYTMGNEVFLMYAVHQ
ESIVVPENIDAIRASLNLASAEDSIKITNTSLNISKGYLI
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgattaaagtagcattaaatggttatggaactattgggaaaagagtggctaacgcaatt
atgttacaacccgatatgaagttaataggcattgcaaaaacttcgcctaattatgaggca
tttatagcacaaaaaatgggtataaatatcttcgttcctcaggaatcaattaaatccttt
gatgaggcagggataaaagttgcgggaaatatagaggatatgataaaagaggctgatatt
gtagttgatgctactcctaatggagtcggtgctcaatataaggaactttatcaaaaattt
ggtaaaaatgcgatatttcaaggaggagaaaaggctaacgttgcagatgtttctttctcc
tctctttgtaattataatgaagctataggaaagaaatacataagagtggtgtcctgtaat
actactgcgttacttagaactatatgcactttaaacaaactaagtaaagtcgaaaaagtt
agggctacaatagttagaagggccgcagatcctaaagaggttaaaaagggtcctataaat
gctttagtaccagaccctgcttcagtccctagtcatcacgctaaggacgttaatagcgtg
cttaaagatctggatataataacaatggcagttattgctccaacaacatatatgcacatg
catttacttaacgtaactcttaagtctcaagtaagtaaagaggacgtcataaatcagttt
ttgaatacaaataggtttctgcttgtaagaggtaaatcgaaagttaattctactgcggaa
attattgaggttgcaagagatttaggtagaataaggaatgatattccggaagtagtaata
tttgaagattcaatttatactatgggtaatgaagtatttttaatgtacgcggttcatcaa
gagtctatagtagttcctgagaacatcgatgcaataagggcttcgttaaatttggccagt
gcagaagactcgataaaaataacaaatactagtctaaatataagtaaagggtatcttata
tga

DBGET integrated database retrieval system